KEGG   Helicobacter pylori 35A: HMPREF4655_21255Help
Entry
HMPREF4655_21255  CDS       T01892                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hpo  Helicobacter pylori 35A
Brite
Enzymes [BR:hpo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HMPREF4655_21255 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AMA-1
Motif
Other DBs
NCBI-ProteinID: ADU41335
UniProt: E6S2T3
LinkDB All DBs
Structure
PDB: 

Position
1262541..1263182
Genome map
AA seq 213 aa AA seqDB search
MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSS
GGVFNNAAQIYNHDFYWDCLSPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSG
WNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYGH
INWHFVSQCYEWAKKEGLGSVDYYINELVHKKA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttacattacgagaattgccttttgctaaagacagcatgggagattttttaagcccc
gtagcgtttgatttccaccatgggaaacaccatcaaacttatgtgaataatttgaacaat
ctcatcaaaggcacagattttgagaaaagttctttgtttgctattttgacaaaatctagc
ggaggcgtgtttaataacgccgctcaaatttataaccacgatttttattgggattgccta
agccctaaagcgaccgccttaagcgatgaattaaaaggggctttagaaaaagatttcggc
tcattggaaaaatttaaagaagacttcattaagagcgcgaccactttgtttggctctggt
tggaattgggcagcgtataatttagacactcaaaaaattgaaatcattcaaacgagcaac
gctcaaaccccagttacggataaaaaagtgccgcttttagtggtggatgtgtgggagcat
gcttattatattgaccataaaaacgcgcgccctgtgtatttggaaaaattctatgggcat
atcaattggcattttgtttctcaatgctatgaatgggcgaaaaaagaaggcttaggatca
gtggattactacatcaacgagttggtgcataaaaaagcttaa

DBGET integrated database retrieval system