KEGG   Helicobacter pylori 2017: hp2017_0139Help
Entry
hp2017_0139       CDS       T01913                                 

Gene name
aroF
Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01130  Biosynthesis of antibiotics
hpq01230  Biosynthesis of amino acids
hpq02024  Quorum sensing
Module
hpq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hpq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    hp2017_0139 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    hp2017_0139 (aroF)
Enzymes [BR:hpq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     hp2017_0139 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2 Tsi6 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ADZ49219
LinkDB All DBs
Position
135562..136911
Genome map
AA seq 449 aa AA seqDB search
MSNTTWSPTSWHSFKIEQHPTYKDEQELERVKKELRSYPPLVFAGEARNLQERLAQVIDN
KAFLLQGGDCAESFSQFSANRIRDMFKVMMQMAIVLTFAGSIPIVKVGRIAGQFAKPRSN
ATEILDDEEVLSYRGDIINGISKKEREPKPERMLKAYHQSVATLNLIRAFAQGGLADLEQ
VHRFNLDFVKNNDFAQKYQQIADRITQALGFMRACGVEIERTPILREVEFYTSHEALLLH
YEEPLVRKDSLTNQFYDCSAHMLWIGERTRDPKGAHVEFLRGVCNPIGVKIGPNASVSEV
LELCDVLNPHNIKGRLNLIVRMGSKIIKERLPKLLQGVLKEKRHILWSIDPMHGNTVKTN
LGVKTRAFDSVLDEVKSFFEIHRAEGSLASGVHLEMTGENVTECIGGSQAITEEGLSCHY
YTQCDPRLNATQALELAFLIADMLKKQRA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacaacttggtcgccaacttcatggcattcttttaagatagagcaacacccc
acttacaaagatgagcaagaattagaaagggtcaaaaaagaattacgctcctaccctcct
ttagtgtttgctggcgaagcgaggaacttgcaagagcgcttagcccaagtcattgacaat
aaagcgtttttgttgcaagggggcgattgtgcggagtcgttttcccaatttagcgctaac
cgaattagggacatgtttaaagtgatgatgcaaatggcaatcgttctcacttttgctggc
tctataccgatcgtgaaagtggggcgcattgccgggcaatttgccaaacctcgctccaat
gcgactgaaatactggatgatgaagaagtgttgagttacagaggggatattatcaatggg
atttctaaaaaagaaagagagccaaagcctgaaagaatgcttaaagcttaccatcaaagc
gtagcgactttaaaccttatcagagcctttgctcaaggcgggttagcggatttggagcaa
gtgcatcgtttcaatttggattttgtcaaaaataacgatttcgcacagaaataccagcaa
atcgctgatcggatcacgcaagctttagggtttatgcgagcgtgtggggtggagatagag
cgaacgcctatccttagggaagtggaattttacaccagtcacgaagcgttactgctccat
tatgaagagcctttggtgcgtaaggatagtttgactaaccagttttatgattgctccgcg
cacatgctgtggattggcgaaaggacaagagatcctaaaggcgcgcatgtggagttttta
aggggagtttgtaaccctattggcgtgaaaatcgggcctaatgcgagcgtgagcgaagtg
ttagaattgtgcgatgttttaaacccgcacaacattaaggggcgtttgaatttgatcgtg
cgcatgggttctaaaatcattaaagagcgtttgcctaagcttttacaaggggtgttgaaa
gaaaaacgccatattttatggagcattgatcccatgcatggcaacacggtcaaaaccaac
ttgggggttaaaacaagggcttttgatagcgtgttagatgaagtgaaaagcttttttgaa
atccatagggctgaagggagtttggcttcaggggttcatttggaaatgacaggagaaaat
gttacagaatgtatcggtggctcgcaagcgatcaccgaagagggtttgagctgccattac
tatacgcaatgcgatccaagactaaacgccactcaagccctagaactcgcttttttaatc
gctgacatgcttaaaaaacaacgcgcttga

DBGET integrated database retrieval system