KEGG   Haemophilus parainfluenzae: PARA_01230Help
Entry
PARA_01230        CDS       T01605                                 

Definition
(GenBank) transpeptidase involved in peptidoglycan synthesis (penicillin-binding protein 2)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00550  Peptidoglycan biosynthesis
hpr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PARA_01230
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PARA_01230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpr01011]
    PARA_01230
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PARA_01230
Peptidoglycan biosynthesis and degradation proteins [BR:hpr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   PARA_01230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer SURF1
Motif
Other DBs
NCBI-ProteinID: CBW14230
UniProt: E1W1J3
LinkDB All DBs
Position
116674..118650
Genome map
AA seq 658 aa AA seqDB search
MNLKKFFAAPTNEPIRDKKAERNLFARRTLVAFIGILALSGVLFANIYHLQVVNYDMYQT
RSNGNRIKLLPLPPTRGLIYDRYGELLAENLTFFGLYIVPEKTENLDRTFEELRYIVGLT
DEDIEHFKKERRRGTRYTPILLKPSLTEEQIARFAVNQYKYPSLDVRPYFKRNYLYGEAM
THILGYVGRINDRDVERLKKEEKFANYSGSTDMGKLGIERYYEEQLHGTTGFEEVEINNR
GKVIRKLREQPATAGKSIHLTIDFTLQRYIMSLLSGQKGAVVVLDPKDNSVLAMVSTPSY
DNNLFVDGISASDYKRLLNDPARPLYSRATQGVYPPASTVKPFVAVAALTEGVITPHTTI
FDPGYWMLPNSTKRFRDWKKSGHGYTDLNKAITESSDTFFYQTAFNLGIDRFSMWMKRFG
FGMPTGIEIQEEAAANMPSKEWKQKRYKKPWVQGDTISVGIGQGYWTATPLQVAKATSIV
VNNGKIHTPHLMKSVEGSIIEPYQDPLLYEDITDPKQAYWDAAKRGMFNVVNSGAGTGRK
AFVGTNYHVAGKSGTAQVFSLKENQKYNAAGLKKELHDHAWFTAYAPYEDPKLVVTIILE
NAGGGSSNAAPIVRQIMDFYLNKRLPQIERQQNAEKEKMTDQTELDTPLQEPQPSENE
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaagaaattctttgcagccccaaccaacgaaccgatccgcgataaaaaagcg
gagcggaacctgtttgcgcgtcgaacattggtagcattcatcggtattttagccctaagt
ggtgtgctatttgctaatatttaccatctccaagtggtgaattacgacatgtaccaaact
cgctcaaatggtaaccgtattaaattgcttccacttcctcctactcgcggattgatttat
gaccgttacggtgaattactggcagaaaacctcacctttttcggtttatatatcgtgccg
gaaaaaacggaaaatttagaccgcacttttgaagaattgcgctatattgtggggctcaca
gacgaagacattgagcatttcaaaaaagaacgtcgccgtggcacacgttatacaccgatt
ttactcaaaccaagcttaacggaagaacaaatcgcccgctttgcagtaaaccagtataaa
tatccaagccttgatgttcgtccttatttcaaacgaaattacctatatggcgaagccatg
actcacattttaggttatgtgggacgcattaatgaccgagatgttgagcgcctaaaaaaa
gaagaaaaatttgctaactattccggttctacggacatggggaaactgggtattgaacgt
tattacgaagaacaactccatggtacaaccggtttcgaagaggttgaaattaataaccgt
ggtaaagttattcgtaaactacgtgaacaaccagccaccgcgggtaaaagtattcatctg
actatcgattttactcttcaacgctatattatgtcgctcctttcaggtcaaaaaggcgct
gttgttgtgcttgacccgaaagacaacagtgtattagcgatggtttcaacaccaagctat
gataataatttattcgtggatgggatttccgctagcgattataaacgcttattaaacgac
cctgctcgcccactttatagtcgtgcaacacaaggggtctatccaccagcctctacggta
aaaccatttgttgctgttgctgcattaacggaaggggtgattacgcctcataccaccatt
tttgacccaggttactggatgcttccaaactcgacaaagcgtttccgagattggaaaaaa
tcagggcacggctatacggatttaaataaagccattacggaatcatcggataccttcttc
tatcaaaccgcctttaatttaggcattgatcgtttctctatgtggatgaaacgctttggc
tttggtatgccgacaggtattgaaattcaagaagaagctgcggccaatatgccgagtaaa
gaatggaaacaaaaacgttataaaaaaccttgggtacaaggcgatacgatctctgtgggg
attggacaaggttattggacggctacaccattacaagtggcaaaagcgacctctattgtg
gtcaataacggtaaaattcatacgcctcatttaatgaaatcagtggaaggctctatcatt
gagccctatcaagacccacttttatatgaggatattactgatccgaaacaagcttattgg
gatgccgctaaacgcgggatgtttaatgtcgtgaattctggtgcaggaacaggacgaaaa
gcctttgtaggcactaattaccatgtagctgggaaatccggtactgcacaggtattcagc
ttaaaagaaaaccaaaaatataatgctgcaggattgaaaaaagaattgcatgatcatgct
tggttcactgcttatgcaccttatgaagatccgaaattagttgtcaccattattttagaa
aatgcggggggcggctcaagtaatgccgcgccaattgtgcgtcaaattatggatttctac
ctaaataaacgcttgccgcaaattgaacgtcaacaaaatgctgaaaaagaaaagatgacg
gaccaaactgagttagacacaccattgcaagaaccccaaccaagtgagaatgaataa

DBGET integrated database retrieval system