KEGG   Haemophilus parainfluenzae: PARA_01260Help
Entry
PARA_01260        CDS       T01605                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00550  Peptidoglycan biosynthesis
hpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PARA_01260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hpr01002]
    PARA_01260
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpr01011]
    PARA_01260
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PARA_01260
Peptidases [BR:hpr01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   PARA_01260
Peptidoglycan biosynthesis and degradation proteins [BR:hpr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PARA_01260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 tRNA-synt_1_2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CBW14233
UniProt: E1W1J6
LinkDB All DBs
Position
120701..121888
Genome map
AA seq 395 aa AA seqDB search
MLKQSAKLKKIVLFSGLMAASTFAAAEDLQYGIAVPEVNAQTYVLMDYNSGAVLASLNPD
QRQYPASLTKMMTSYVVGAALKQGKIHNEDMVTIGESAWGRNFPDSSKMFLNLNQQVSVG
DLNKGIIIVSGNDACVAVAEHISGTVANFVDTMNKYVQQFGLKNTNFTTPHGLDDPNQYS
TARDMAIIGAHIIRDLPEEYKIYAEKDFTFNKIKQPNRNGLLWDKTINVDGMKTGHTSQA
GYNLVASATSPNNMRLISVVMGVPTYKGREVESKKLLQWGFANFETLKAHKANEKISTQS
VYYGDKGEIQLGLLQDGFITVPKGKQADLKARYELDNKYLQAPLTKGQVVGKIVYQLDGK
DVAIVNLQALEDVQEGGFFGKGWDWLVLTIKGLFD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacaatctgcaaaattgaaaaaaattgttctattctcgggattaatggcagcc
tcaacattcgctgcagctgaagatcttcaatacggtattgctgtaccagaagtgaatgcg
caaacctatgttttaatggattacaattctggtgcggtgcttgcatcacttaatccagat
caacgccaataccctgcttcattaactaaaatgatgactagttatgtggtaggtgctgca
ttaaaacaaggcaaaattcataatgaagatatggtcaccattggcgaaagtgcttgggga
agaaacttcccagattcttcaaaaatgttcttaaatttaaatcaacaagtatccgtaggt
gatttaaacaaaggcattatcattgtttcaggtaatgatgcttgtgtcgcagtggcagaa
catatttctggtaccgtggctaacttcgttgataccatgaataaatacgttcaacaattt
ggcttaaaaaataccaacttcactacgccacacggtttagacgatccaaaccaatattca
accgcacgtgatatggcgattattggtgcgcacattattcgtgatttaccggaagaatat
aaaatctacgcagaaaaagacttcacctttaacaaaatcaaacaacctaaccgtaacggc
ttactatgggacaaaaccattaatgtggacggtatgaaaacaggtcacactagccaagca
ggttataaccttgttgcatcggcgacaagtccaaataatatgcgtttgatttctgttgtg
atgggcgtaccaacctataaaggtcgtgaagtagaaagcaaaaagctcttacaatggggt
tttgctaactttgaaacattaaaagcccacaaagccaatgaaaaaatttcaacacaatcg
gtttactacggtgataaaggtgaaattcaacttggtttattacaagatggctttattact
gtgccaaaaggcaaacaagcagacttaaaagcacgttacgaattagataacaaatactta
caagcacctttaacaaaaggtcaggttgttggtaaaatcgtttatcaactagatggcaag
gatgtggcaattgttaatcttcaagcattagaagacgtgcaagaaggtggtttcttcggt
aaaggttgggactggttagtgttaacaatcaaaggattatttgattaa

DBGET integrated database retrieval system