KEGG   Haemophilus parainfluenzae: PARA_03820
Entry
PARA_03820        CDS       T01605                                 

Definition
(GenBank) ADP-heptose:LPS heptosyl transferase I
  KO
K02841  heptosyltransferase I [EC:2.4.-.-]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00540  Lipopolysaccharide biosynthesis
hpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PARA_03820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpr01005]
    PARA_03820
Enzymes [BR:hpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     PARA_03820
Lipopolysaccharide biosynthesis proteins [BR:hpr01005]
 Core region
  PARA_03820
SSDB
Motif
Pfam: Glyco_transf_9 UPF0181 SecD-TM1 Thioredoxin_9
Other DBs
NCBI-ProteinID: CBW14489
UniProt: E1W2A2
LinkDB
Position
complement(387011..387964)
AA seq 317 aa
MKVCVIKTSSMGDVIHTLPALTDAQRAIPNLSIDWVVEENFAEIPRWHSAVNQIIPIALR
RWRKSPFSAQTKNEWKSYRTLLQANQYDAVIDAQGLFKSAFFATRLANGVKHGYDRKSIR
EPIASLFYDKKYAISYQQHAVERIRQLFAQALSYPLPKEKGDYDIARHFISADSIEPYVI
FFHSTTRDEKHWSEHEWRNLIEKLTALSVQVRLPWGNVKEKARAERLAVGLSHVVVLPKL
SLNELAYQIANAKAAVSVDTGLAHLTAALDKPNITLYGATDPTLIGCYGRNQHYLIANSM
EKITSEQVFSSLNTLIK
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaaagtatgtgtgattaagacttcctctatgggggatgtgattcatactttgccggca
ttgactgatgcacagcgtgctattcctaatctctctattgattgggtggtggaagagaat
tttgcagaaattccacgttggcattcggcagtgaatcaaatcattccaattgccttaaga
cgctggcgaaaatcgcctttttcggctcaaacaaagaacgaatggaaatcttaccgcact
ttattacaagccaatcaatatgatgccgtaattgacgcgcaagggctttttaagagcgct
ttttttgcgacacgcttagctaatggcgtcaaacatggctatgatcgcaagagtatccgt
gagccgatagcttccttgttttacgataaaaaatacgcgatttcttatcaacaacatgcg
gtagaacgcattcgtcaactttttgcacaagcattatcttatccattaccgaaagagaaa
ggggattatgacattgcgcgtcattttatttccgcagactctatcgaaccttatgtgatc
ttttttcattctacgacaagagatgaaaagcattggtcagaacatgaatggcgaaattta
attgaaaaactgaccgcactttctgttcaagttcgtttaccttggggaaatgtaaaagaa
aaggcgagagcagagcgattagcagtaggtttatctcatgtggtcgttttgcctaaactt
tcattaaatgaattggcttaccaaatagctaatgcaaaagccgcggtgtctgtggatact
gggcttgcgcatttaacggcagcactggataaacccaatattacgctttatggcgcaact
gatccgaccttaattggttgttatggtagaaatcagcattatttaattgccaattcgatg
gagaaaattacctcagagcaggtcttttctagcctaaatacattaattaaatag

DBGET integrated database retrieval system