KEGG   Haemophilus parainfluenzae: PARA_04560Help
Entry
PARA_04560        CDS       T01605                                 

Definition
(GenBank) protein chain elongation factor EF-Tu (duplicate of tufA)
  KO
K02358  elongation factor Tu
Organism
hpr  Haemophilus parainfluenzae
Brite
KEGG Orthology (KO) [BR:hpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hpr03012]
    PARA_04560
   03029 Mitochondrial biogenesis [BR:hpr03029]
    PARA_04560
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpr04147]
    PARA_04560
Translation factors [BR:hpr03012]
 Eukaryotic Type
  Elongation factors
   PARA_04560
 Prokaryotic Type
   PARA_04560
Mitochondrial biogenesis [BR:hpr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PARA_04560
Exosome [BR:hpr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PARA_04560
  Exosomal proteins of breast cancer cells
   PARA_04560
  Exosomal proteins of colorectal cancer cells
   PARA_04560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: CBW14563
UniProt: E1W2H6
LinkDB All DBs
Position
complement(449114..450298)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKPTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacactac
ggtggtgcagctcgtgcattcgaccaaatcgataacgcgccagaagaaaaagcgcgtggt
atcaccatcaacacttcacacgttgaatacgatactccaactcgtcactatgcacacgtt
gactgcccaggacacgcggactatgttaaaaacatgattaccggtgcggcgcaaatggac
ggtgctatcttagtagtagcagcgacagatggtccaatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgtaccttacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctttctcaa
tatgacttcccaggtgacgatactccaatcgtacgtggttctgcattacaagcattaaac
ggcgttgcagaatgggaagaaaaaatccttgagttagcaaaccacttagatacttacatt
ccagagccagagcgtgcaattgaccaaccgttccttcttccaatcgaagacgtgttctca
atttcaggtcgtggtacagtagtaacaggtcgtgttgagcgtggtatcattcgtactggt
gatgaagttgaaatcgttggtatcaaaccaacagcgaaaacaacagtaactggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggtaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcact
ccacacactgatttcgaatcagaagtttacgtattatcaaaagatgaaggtggtcgtcac
actccattcttcaaaggttaccgtccacagttctatttccgtacaactgacgtaactggt
acaatcgagttaccagaaggcgtggaaatggtaatgcctggtgataacatcaaaatgaca
gtaagcttaatccacccaatcgcgatggaccaaggtttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcaggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system