KEGG   Hydrogenophaga pseudoflava: HPF_05295Help
Entry
HPF_05295         CDS       T06073                                 

Gene name
maeB1
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hpse  Hydrogenophaga pseudoflava
Pathway
hpse00620  Pyruvate metabolism
hpse01100  Metabolic pathways
hpse01120  Microbial metabolism in diverse environments
hpse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPF_05295 (maeB1)
Enzymes [BR:hpse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     HPF_05295 (maeB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH AlaDh_PNT_C ELFV_dehydrog DUF4454
Motif
Other DBs
NCBI-ProteinID: QBM27087
UniProt: A0A4P6WUE4
LinkDB All DBs
Position
complement(1064833..1067133)
Genome map
AA seq 766 aa AA seqDB search
MTPAEQALRDAALEYHRSPNKGKIAVVPTKPLSNQRDLSLAYSPGVAFPCLAIEAEPALA
SEYTSRGNLVGVITNGTAVLGLGDIGPLASKPVMEGKGCLFKKFAGIDVFDIELAERDPD
KLVDIIAALEPTLGGVNLEDIKAPECFYIERKLRDRMKIPVFHDDQHGTAIISSAALING
LELVKKDIGAVKVAVSGAGAAAIACLDLMVNLGVNIENILVCDSKGVIQTERDDAKAGKL
DESKQRYCRTSSARTLADAMNGADVFLGCSAAGVVDADMVKSMARQPIILALANPEPEIR
PEVAKAARPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGATKITEEMKMACVRQIADL
TKAETSDEVAAAYAGQDLVFGPDYIIPKAFDTRLILKIAPAVAQAAADSGVATRPITDMD
AYRQSLSRFVTQTGILMRPIFNAAKALPANKKRVAYADGEDERALRAAQMAIDDGLATPI
LIGRPAVIEARIQKAGLRIRLGVDVENVNPEGDPRFRQYWEHYHGLMKRNGATPEVAKAA
VRRSNTIIGSLMLSLGDADALICGLVGTYATHLERIDAILGKAPGVNNYAAVNALMTASG
PLFIADTYVNEDPAAEQLAEIAWMAAQQVQRFGLPPKVAFLSHSSFGSSKRASAKKMRAA
RDLFVAQHPGIECDGELHGDAALQPEIRQAYLGDSTLSGSANLLVCPNVDAANILYNVLK
TTASGGVTVGPVLTGVARPAYILTPAATVRRVLNMTALAAAASPRG
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgccgaacaagccctgcgcgacgccgcgctcgaataccaccgctcgcccaac
aagggcaagatcgccgtcgtcccgaccaaaccgctgtccaaccagcgcgacctgtcgctg
gcctattcgccgggcgtggcctttccctgcctggccatcgaggccgagccggccctggcc
tcggagtacaccagccgcggcaacctggtgggcgtgatcaccaacggcacggccgtgctg
ggcctgggtgacatcggcccgctggcctccaaaccggtgatggagggcaagggctgcctg
ttcaagaagttcgccggcatcgacgtgttcgacatcgagctggccgagcgcgacccggac
aagctggtcgacatcatcgcggcgctggagcccacgctggggggggtgaacctggaagac
atcaaggcgcccgagtgcttctacatcgagcgcaagctgcgcgaccgcatgaagatcccg
gtcttccacgacgaccagcacggcacggccatcatctccagcgcggcgctgatcaacggc
ctggaactggtcaagaaggacatcggcgctgtcaaggtcgctgtcagcggcgcgggtgcg
gcggccatcgcctgcctggacctgatggtcaacctgggcgtgaacatcgagaacatcctg
gtctgtgactccaagggcgtgatccagaccgaacgcgacgacgccaaggccggcaagctg
gacgagtccaagcagcgttactgccgcacctcgtcggcgcgcaccctggccgacgccatg
aacggcgccgacgtgttcctgggctgctcggcggccggcgtggtggacgccgacatggtc
aagagcatggcgcgccagcccatcatcctggcgctggccaaccccgagcccgagatccgc
cccgaagtggccaaggccgcgcggccggactgcatcatcgccaccggccgttcggactac
ccgaaccaggtcaacaacgtgctttgcttcccttacatcttccgtggcgcgctggactgc
ggcgcgaccaagatcacggaagaaatgaagatggcctgcgtgcgccagatcgccgacctg
accaaggccgagaccagcgacgaagtggccgccgcctacgccgggcaggacctggtgttc
ggccccgactacatcatccccaaggctttcgacacgcgcctgatcctcaagatcgctccg
gccgtggcccaggctgccgccgactcgggcgttgcgacccgcccgatcaccgacatggac
gcctaccgccagtcgctctcgcgcttcgtgacgcagaccggcatcctgatgcgcccgatc
ttcaacgccgccaaggccctgcctgcgaacaagaagcgcgtggcctacgccgacggcgag
gacgagcgcgcgctgcgcgccgcgcagatggcgatcgacgacggcctggccacgccgatc
ctgatcggccgcccggccgtgatcgaggcgcgcatccagaaggcgggcctgcgcatccgc
ctgggtgtggacgtcgagaacgtcaaccccgagggcgacccgcgctttcgccagtactgg
gagcactaccacggcctgatgaagcgcaacggcgccacgcccgaagtggccaaggccgcc
gtgcgccgctccaacaccatcatcggctcgctgatgctgtcgctgggcgatgcggatgcg
ctgatctgcggcctggtcggcacctacgccacccatctggagcgcatcgacgccatcctg
ggcaaggcgccgggcgtgaacaactacgccgcggtcaacgcgctgatgacggccagcggc
ccgctgttcatcgccgacacctacgtcaacgaggacccggcggccgagcagctggccgag
atcgcctggatggcggcgcagcaggtgcagcgcttcggcctgccacccaaggtggccttc
ctctcgcactccagcttcggttccagcaagcgcgcgtcggcgaagaagatgcgcgccgcg
cgcgacctgttcgtggcccagcatccgggcatcgagtgcgacggcgagctgcacggcgac
gccgcgctgcaacccgagatccgccaggcctacctgggcgactcgacgctgagcggctcg
gccaacctgctggtctgccccaacgtggacgccgccaacatcctctacaacgtgctcaag
accaccgccagcggcggcgtgaccgtgggcccggtgctgaccggcgtggcccgccccgcc
tacatcctgacgccggccgccaccgtgcgccgcgtgctcaacatgacggccctggccgca
gcggccagcccgcgcggctga

DBGET integrated database retrieval system