KEGG   Hydrogenophaga pseudoflava: HPF_09840Help
Entry
HPF_09840         CDS       T06073                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hpse  Hydrogenophaga pseudoflava
Brite
KEGG Orthology (KO) [BR:hpse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HPF_09840 (ahpF)
Enzymes [BR:hpse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HPF_09840 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 Glutaredoxin HI0933_like FAD_oxidored DAO FAD_binding_3 NAD_binding_8 Thi4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QBM27987
UniProt: A0A4P6WWN0
LinkDB All DBs
Position
2019128..2020708
Genome map
AA seq 526 aa AA seqDB search
MLDDTLKAQLQQYLGMLRQPITLIASLDESDTGAEMRELLQTIASLSDKVTLDTAGNDAR
KPSFVIARAGETTGVRFAGLPLGHEFTSLVLALLWTGGHPPKVEQEVIDSIKSLDGEYSF
EVYMSLTCHNCPDVVQALSLMAIVNPKIRTVVIEGGAFQQEVTEREIMAVPMVFMNGQVF
ASGRMSVEEIVAKLDTKSGEREAAKLNAKDAYDVLIVGGGPAGAAAAVYAARKGIRVGIA
AERMGGQVNDTMAIENYISVLETDGPKFAAALEAQVRHYEVDVMNLQRADKLIPASEPGG
LVQVQMANGGVLKARSVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRTAVI
GGGNSGVEAAIDLAGIVQHVTLIEFADQLKADAVLVSKLKSLPNVTIHVNAQTTEITGDG
SKVNGLKFKDRVSGEEQLVPLEGVFVQIGLVPNTEFLKGTVELSRFGEIVVDAKGHTNVE
GVFAAGDCTTVPYKQIVIAAGEGAKAALSAFDHLIRTPVPAEMVPA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacaccctcaaagcccagttgcagcagtacctcggcatgctgcgccagccc
atcacgctgatcgcgtcgctggacgagagcgacaccggcgccgagatgcgcgagctgttg
cagaccattgccagcctgtcggacaaggtcacgctggacaccgcgggcaacgacgcccgc
aagccgtccttcgtgatcgcccgtgccggcgaaaccacaggcgtgcgctttgccggcctg
ccgctgggccacgagttcacctcgctggtgctggcgctgctgtggaccggtggccacccg
cccaaggtcgagcaggaggtgatcgactcgatcaagtcgctcgacggcgagtacagcttc
gaggtctacatgtccctgacctgccacaactgcccggacgtggtgcaggcgctgtcgctc
atggccatcgtcaacccgaagattcgcaccgtggtgatcgagggtggcgccttccagcag
gaagtgaccgagcgcgagatcatggccgtgcccatggtgttcatgaacggccaggtgttc
gcctccggccgcatgagcgtggaagagatcgtggccaagctcgacaccaaatccggcgaa
cgcgaagccgccaagctcaacgccaaggacgcctacgacgtgctgatcgtcggcggtggc
ccggccggtgctgcggcggcggtgtacgcggcccgcaagggcatccgtgtgggcatcgcg
gccgagcgcatgggtggtcaggtcaacgacaccatggccatcgagaactacatctcggtg
ctggaaaccgacggcccgaagttcgccgccgcgctggaagcccaggtgcgccactacgag
gtggacgtgatgaacctgcagcgtgccgacaagctgatccccgccagcgagccgggcggc
ctggtgcaggtgcagatggccaacggtggcgtgctcaaggcgcgcagtgtgatcctgtcc
accggtgcgcgctggcgcaacgtcaatgtgccgggcgagcaggaatacaagaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaaaggcaagcgcacggcggtcatc
ggcggcggcaactcgggcgtggaggccgccatcgacctggccggcatcgtccagcacgtc
acgctgatcgagttcgccgaccagctcaaggccgacgcggtgctggtgagcaagctcaag
agcctgcccaacgtgaccatccacgtgaacgcgcagaccaccgagatcaccggcgacggc
agcaaggtcaacggcctgaagttcaaggaccgtgtgagtggtgaagaacagctggtgcct
ctggaaggcgtgttcgtgcagatcggtctggtgcccaacaccgagttcctcaagggcacg
gtcgagctcagccgtttcggcgagatcgtggtcgacgccaagggccacaccaacgtggaa
ggcgtgttcgcagcgggcgactgcaccacggtgccgtacaagcagatcgtgatcgctgca
ggcgagggcgccaaggccgcgctcagtgcgttcgaccacctgatccgcacccccgtgccg
gccgagatggtgccggcctga

DBGET integrated database retrieval system