KEGG   Hydrogenophaga pseudoflava: HPF_10750Help
Entry
HPF_10750         CDS       T06073                                 

Gene name
fadJ1
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hpse  Hydrogenophaga pseudoflava
Pathway
hpse00071  Fatty acid degradation
hpse00280  Valine, leucine and isoleucine degradation
hpse00281  Geraniol degradation
hpse00310  Lysine degradation
hpse00362  Benzoate degradation
hpse00380  Tryptophan metabolism
hpse00410  beta-Alanine metabolism
hpse00640  Propanoate metabolism
hpse00650  Butanoate metabolism
hpse00903  Limonene and pinene degradation
hpse00930  Caprolactam degradation
hpse01100  Metabolic pathways
hpse01110  Biosynthesis of secondary metabolites
hpse01120  Microbial metabolism in diverse environments
hpse01130  Biosynthesis of antibiotics
hpse01200  Carbon metabolism
hpse01212  Fatty acid metabolism
Module
hpse_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HPF_10750 (fadJ1)
   00650 Butanoate metabolism
    HPF_10750 (fadJ1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPF_10750 (fadJ1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPF_10750 (fadJ1)
   00310 Lysine degradation
    HPF_10750 (fadJ1)
   00380 Tryptophan metabolism
    HPF_10750 (fadJ1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HPF_10750 (fadJ1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HPF_10750 (fadJ1)
   00281 Geraniol degradation
    HPF_10750 (fadJ1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPF_10750 (fadJ1)
   00930 Caprolactam degradation
    HPF_10750 (fadJ1)
Enzymes [BR:hpse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HPF_10750 (fadJ1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HPF_10750 (fadJ1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HPF_10750 (fadJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: QBM28166
UniProt: A0A4P6X0T9
LinkDB All DBs
Position
complement(2209991..2212150)
Genome map
AA seq 719 aa AA seqDB search
MITKTIRYELANGIATITFDEQGSPVNTMCLQWQDDLDAIAAQVAQDKAQLKGIVLASAK
STFFAGADLKGVMRSTEADGPRVFREIERIKKNFRILETQGVPVVSCLNGAALGGGWEVA
LVGHHRIAVNNPKIQFGLPEITLGLIPGGGGITKMTRLLGLMAAQPYVLESKLFGPEEAL
KIGVVHELVATPEELLPRALAFIESAQGKPEACTHVWDRKDYKMPGGTPSNPKIAGMLTV
APAVLKQKTRGLYPAPEAALAAMVEGAMVDFDTAMRVESRYLAGLMTGGVARNMINTFFF
NMNAIKGGQSRPKDVPRYQPKKVGVLGAGMMGSGIAYAQATRGIATVLKDVSVEAAEKGK
SYTTKLTQKRVDKGQMSAEKQQGILNLITPTASAADLKGCDLIIEAVFEQRELKAMVTKE
AEPMLAEGGFFASNTSTLPISGLAQASRDAKKFVGIHFFSPVDKMKLVEIIRGQDTDDET
IARAYDYVQALGKLPIVVNDSRGFYTSRTFGTFVMEGAAMLGEGIPAPVIENAAMQAGMP
VGPLAVLDETALSLSVHVLEQTRIDFQKEGQQYVATPGETLVEQMVKQHKRPGRAAGGGF
YDYPEGGKKHLWPQLKALYEKPGVDWNLQDVKDRLLYRQAVETARCLAEGVLTSVHDGNI
GSIFGIGFPAWTGGALQFIYGMGIEAFEQRCAELAARHGSGFILADAVKAALRQHQPQY
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaagaccatccgctacgaactcgccaacggcattgccaccatcaccttcgac
gagcagggctcccccgtcaacaccatgtgcctgcagtggcaggacgacctggacgccatc
gcggcgcaggtggcccaggacaaggcccagctcaaaggcatcgtgctggcctcggccaag
agcaccttctttgcgggtgcggatctcaagggcgtgatgcgctcgaccgaggccgacggc
ccgcgcgtgttccgcgagatcgaacgcatcaagaagaacttccgcatcctcgaaacgcag
ggcgtgccggtggtgagttgcctcaacggtgcggcgctcggcggtggctgggaggtggcg
ctggtcggtcaccaccgcatcgcggtcaacaaccccaagatccagttcggcctgcccgag
atcacgctgggcctgattcccggtggcggcggcatcaccaagatgacgcggttgctgggc
ctgatggccgcgcagccctacgtgttggagagcaagctgttcgggccggaggaggcgctg
aagatcggcgtggtgcacgaactggtcgccacacccgaggagctgctgccgcgcgcgctc
gccttcatcgaatcggcgcaaggcaagcccgaggcctgcacccacgtctgggaccgcaag
gactacaagatgcccggcggcacgccgagcaaccccaagatcgccggcatgctgacggtg
gcgccggccgtgctcaagcagaagacgcgcggcctctaccccgcgcccgaggcggcgctg
gcggccatggtcgaaggcgcgatggtcgacttcgacaccgccatgcgcgtggaaagccgc
tacctggccggactgatgaccggtggcgtggcgcgcaacatgatcaacaccttcttcttc
aacatgaacgccatcaagggcggtcagtcgcgtccgaaggacgtgccgcgctaccagccg
aagaaggtgggtgtgctgggtgccggcatgatgggctcgggcatcgcctacgcgcaggcc
acgcgtggcatcgccaccgtgctcaaggacgtgagcgtcgaagccgccgagaaaggcaag
tcgtacaccaccaagctcacgcagaagcgggtcgacaaaggccagatgagcgccgagaaa
cagcagggcatcctgaacctcatcacacccaccgccagcgccgccgacctgaaaggctgc
gacctgatcatcgaagccgtgttcgagcagcgcgagctcaaggccatggtcacgaaagag
gcagagcccatgctggccgagggcggcttcttcgccagcaacacctccaccctgcccatc
tccggcctggcgcaggccagccgtgatgcgaagaagttcgtcggcatccacttcttcagc
ccggtggacaagatgaagctggtggagatcatccgcggccaggacaccgacgacgagacc
atcgcccgcgcttacgactacgtgcaggccctgggcaagctgcccatcgtcgtcaacgat
tcgcgcggcttctacaccagccgcaccttcggcaccttcgtgatggaaggcgcggccatg
ctgggcgaaggcatcccggcgccggtgatcgagaacgccgcgatgcaggccggcatgccg
gtcggccccctggccgtgttggacgagaccgcgctcagcctgtcggtgcatgtgctggaa
cagacccgcatcgacttccagaaggagggccagcaatacgtcgccacgcccggcgagacc
ctggtcgagcagatggtcaagcagcacaagcgcccgggccgcgcggccggcggtggcttc
tacgactaccccgagggcggcaagaagcacttgtggccgcagctgaaggcgctgtatgaa
aagccgggcgtcgactggaacctgcaggacgtgaaagaccgcctgctctaccgccaggcg
gtggagaccgcgcgctgcctggccgaaggcgtgctgaccagcgtgcacgacggcaacatc
ggctcgatcttcggcatcggcttcccggcctggacaggcggcgcgctgcagtttatctac
ggcatgggcatcgaggctttcgagcagcgctgcgccgagctggccgcccgccacggcagc
ggcttcatactcgcggacgcggtgaaagccgcgctgcgtcaacaccaaccccagtactga

DBGET integrated database retrieval system