KEGG   Hydrogenophaga pseudoflava: HPF_13145Help
Entry
HPF_13145         CDS       T06073                                 

Gene name
qheDH
Definition
(GenBank) Quinohemoprotein ethanol dehydrogenase type-1 precursor
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
hpse  Hydrogenophaga pseudoflava
Brite
KEGG Orthology (KO) [BR:hpse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HPF_13145 (qheDH)
Enzymes [BR:hpse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     HPF_13145 (qheDH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: QBM28641
UniProt: A0A4P6X4H1
LinkDB All DBs
Position
complement(2742118..2744301)
Genome map
AA seq 727 aa AA seqDB search
MKKGDTMKHGFDTVGGVRQGKAAKRPAIAVMFAVVSLLAMAAPAAMAEAAKGSKAHIAAV
TKKVDGAFIRANEARTNDWPSYGLDYAETRFSRLNQINTANVKDMGLVWSYNLESTRGVE
ATPLVVDGIMYVSASWSIVHAIDVRTGKRIWTFDPKVPREIGYKGCCDVVNRGVALYEGK
VYVGSFDGRLIALDAASGKKVWEKDTIIDRKFSYTITGAPRVFKGKVIIGNGGAEYGVRG
YITAYDAKTGDQKWRWFTVPGDPSKPFEDESMAKAAKTWDPSGKYWEAGGGGTAWDTLTF
DPELNLMYVGTGNGSPWARSKRSPAGGDNLYLASIVALDPDTGKYVWHYQQTPGDNWDFT
STQPMILADLKIDGKPRKVILHAPKNGFFFVIDRTNGKFISAKNFVDVNWASGYDKDGRP
IETPIARVADRPREIIPSALGAHNWHSMSFNPQTGLAYLPAQSVPLTLMDNKDWTFNGVR
PGEPQSNTGWNIATFANVEPPKSAPFGRLIAWDPVQQKAAWTQEHVSPWNGGTLTTAGDL
VFQGTADGRFIAFNARNGEKLWESPTGTGVVAAPSTYLVDGKQYVSIAVGWGGSYGLDRR
ATDRQGPGTVYTFAVGGKAPMPEFVKYRMEELVAGVKYDPAQVPAGTALYVSNCVLCHGV
PGVDRGGSIPNLGYIGAAYIENLDKFVFKGPAMSRGMPDFTGKLSADEVEKIKAFIQGTA
DAIRPQK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggagacacaatgaagcatggcttcgatacggtgggtggcgtccgtcaaggg
aaagccgccaaacgacccgcaatcgccgtgatgttcgcagtggtttcgctgctcgccatg
gcagcgccggctgccatggccgaggcggcgaagggctcgaaggcgcacattgcagccgtg
accaagaaggtcgatggcgcattcatccgcgccaacgaggcgcgcaccaacgactggccc
agctacggcctggactatgccgagacccgcttctcgcgcctgaaccagatcaataccgcc
aacgtaaaagacatgggactggtctggtcgtacaacctcgaatcgacgcgcggcgttgag
gccacaccgctggtggtggacggcatcatgtatgtcagcgcctcgtggagcattgttcat
gcgatcgatgtgcgcaccggcaagcgcatctggacctttgatcccaaggtgccgcgcgag
atcggctacaaaggatgctgcgatgtggtcaaccgtggcgtcgccctgtatgaaggcaag
gtctatgtcggttcgttcgacggccgcctgatcgcgctcgatgcggcgagcggcaaaaag
gtctgggaaaaagacaccatcattgatcgcaagttcagctacaccatcactggtgcgccg
cgcgtgttcaagggcaaagtcatcattggcaacggtggtgccgaatacggcgtgcgcggc
tacatcaccgcctacgatgccaagaccggtgaccagaaatggcgctggttcacggtaccg
ggcgatccgagcaagccgttcgaggatgagtccatggccaaggcggccaagacctgggat
cccagtggcaagtactgggaagccgggggtggcggcaccgcctgggacaccctgaccttc
gaccccgagctcaacctgatgtatgtgggcaccggcaacggctcgccctgggcccgcagc
aaacgcagccccgcgggcggcgacaacctttatctcgcatccatcgtcgcgctcgacccc
gacaccggcaagtacgtctggcactaccagcagaccccgggcgacaactgggatttcact
tcgacccagccgatgatcctggccgatctgaagattgacggcaagccgcgcaaggtgatc
ctgcatgcgccgaagaacggcttcttcttcgtgatcgaccgcaccaacggcaagttcatc
tcggcgaagaatttcgttgacgtgaactgggccagcggctatgacaaggacggacgcccg
atcgaaacgcccattgcgcgcgtggctgaccggccgcgcgagatcattcccagcgcctta
ggtgcacacaactggcattcgatgtcattcaacccgcagaccgggctggcctacttgccg
gcgcagagtgtgccgctcacgctgatggacaacaaggactggacgttcaacggcgtgcgt
ccgggcgaaccgcaaagcaacacgggctggaacatagcgacatttgccaacgtcgagcca
cccaagagtgccccgttcggcaggctgatcgcctgggatccggtgcagcagaaggctgcc
tggacgcaggagcatgtgtcgccgtggaacggcggcacgctgaccaccgcgggcgatctg
gtgttccaaggcacggccgacggccgcttcattgccttcaacgcgcgcaacggcgagaag
ctctgggaatcacccaccggaaccggcgtggtggctgcgccatccacctacctggtggac
ggcaagcagtatgtgtcgattgcggtaggctggggcggctcatatggattggacagacgc
gccaccgaccggcagggaccgggcacggtgtataccttcgcggtcggcggcaaggcgccg
atgcccgagttcgtgaagtaccgcatggaagagctggtggctggcgtgaaatacgacccg
gcccaggtgccggccggcaccgcgctgtatgtcagcaattgcgtgctttgccacggcgtg
ccgggtgttgaccgcggcggcagcattcccaacctgggctacatcggggccgcctatatc
gagaacctggacaagttcgtcttcaagggtccggccatgagccggggcatgcctgacttc
acgggcaaactgagcgcggacgaggtggagaagatcaaggccttcatccagggaacggca
gacgcgatacgtccccagaaatga

DBGET integrated database retrieval system