KEGG   Helicobacter pylori Sat464: HPSAT_03105Help
Entry
HPSAT_03105       CDS       T01897                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt00473  D-Alanine metabolism
hpt00550  Peptidoglycan biosynthesis
hpt01100  Metabolic pathways
hpt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPSAT_03105 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPSAT_03105 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HPSAT_03105 (ddl)
Enzymes [BR:hpt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPSAT_03105 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hpt01011]
 Precursor biosynthesis
  Amino acid ligase
   HPSAT_03105 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK ATPgrasp_TupA VitD-bind_III GARS_A
Motif
Other DBs
NCBI-ProteinID: ADO05364
LinkDB All DBs
Position
complement(607896..608939)
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIALKEALKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLPPLIFTRNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKALDHVLLNEKNRANALNLIGFNFPFIVKPSNAGSSLG
VSVVKEEKELIYALDGAFEYSKEILIEPFIQGVKEYNLAGCKIKKDFCFSYVEEPNKQEF
LDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGALIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKTTLESLAQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggaattttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgatcgcgcttaaagaagcgctaaaggataggattaaatattttatttttttagatgaa
aaccatcatttttatttgattgaagaatctaacatgcattcaaaatacttcgctcagatc
aaagaaaaaaaattaccccccctaatctttacacgcaatggcttgcttaaaaactcgttt
ttaggcgctaagattatagaattgcctttagtgattaatcttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgttgagttataacaaatatttaaccaagctttacgccaaagactta
ggggtaaaggctttagatcatgttcttttgaatgaaaaaaaccgtgctaacgctctaaat
ttgattggctttaattttccttttattgtcaaacctagcaatgccgggagctctttaggg
gtgagcgttgtgaaagaagaaaaagaattgatttacgctttagacggtgcatttgaatat
tctaaagagatcttaatagagcctttcattcagggagtgaaagaatacaatttagccggt
tgcaagatcaaaaaggatttctgtttttcctatgttgaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaataaagcccctaaagcgaatctt
tctaacgccctagaagaacaattgaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgctcatccgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggccaattatttgtttgatgattttaaaacaacgcta
gaaagtttagcgcaatcattacccaaaacccctaaaatccaaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system