KEGG   Helicobacter pylori v225d: HPV225_0746Help
Entry
HPV225_0746       CDS       T01899                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpv  Helicobacter pylori v225d
Pathway
hpv00473  D-Alanine metabolism
hpv00550  Peptidoglycan biosynthesis
hpv01100  Metabolic pathways
hpv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPV225_0746
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPV225_0746
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HPV225_0746
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpv01011]
    HPV225_0746
Enzymes [BR:hpv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPV225_0746
Peptidoglycan biosynthesis and degradation proteins [BR:hpv01011]
 Precursor biosynthesis
  Amino acid ligase
   HPV225_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_TupA RimK GARS_A VitD-bind_III ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADI34822
UniProt: D6XPX8
LinkDB All DBs
Position
741059..741949
Genome map
AA seq 296 aa AA seqDB search
MHSKYFAQIKEKKLPPLILTCNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEF
YRIAFIGPRIEASVLSYNKYLTKLYAKDLGVKALDHVLLNEKNRANALNLIGFNFPFIIK
PSNAGSSLGVSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSY
VEEPNKQEFLDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGALIRCDFFV
IENEVYLNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIPIKNSYLLQIQKNK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaaaatacttcgctcagatcaaagaaaaaaaattaccccccctaatccttaca
tgcaatggcttgcttaaaaactcgtttttaggcgctaagattatagaattgcctttagtg
attaatcttgtgcatgggggcgatggcgaagacgggaaattagcgagcttgttagaattt
tatcgtatcgcttttataggccctaggattgaagcgagcgtgttgagttataacaaatat
ttaaccaagctttacgccaaagacttaggggtgaaggctttagatcatgttcttttgaat
gaaaaaaaccgcgctaacgctctaaatttgattggctttaattttcctttcataatcaag
cctagcaatgccgggagctctttaggggtgagcgttgtgaaagaagaaaaagaattgatt
tacgctttagacggcgcgtttgaatattctaaagaggtcttaatagagcctttcattcag
ggagtgaaagaatacaatttagccggttgtaagatcaaaaaggatttctgtttttcctat
gttgaagagcctaacaaacaggaatttttagatttcaaacaaaaatatttggatttttca
cgcaataaagcccctaaagcgaatctttctaacgccctagaagaacaattgaaagaaaat
tttaaaaaactctataacgatttgtttgatggcgcgctcattcgttgcgatttttttgtc
atagaaaatgaagtgtatcttaatgagatcaaccccattcctggcagtttggccaattat
ttgtttgatgattttaaaacaacgctagaaaatttagcgcaatcattacccaaaacccct
aaaatcccaatcaaaaactcttatttgttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system