Helicobacter pylori 2018: hp2018_1447 Help Entry hp2018_1447       CDS       T01914                                  Symbol folB2 Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hpw  Helicobacter pylori 2018 Pathway hpw00790   Folate biosynthesis hpw01100   Metabolic pathways hpw01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hpw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     hp2018_1447 (folB2) Enzymes [BR:hpw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      hp2018_1447 (folB2)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      hp2018_1447 (folB2)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      hp2018_1447 (folB2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB PRONE Mad3_BUB1_II Motif Other DBs NCBI-ProteinID:  ADZ52171 LinkDB All DBs Position 1454523..1454876 Genome browser AA seq 117 aa AA seqDB search MKTKQAVHIHHLVFETILGILEFERLKPQKISVNVDLFYTELPNKAYLDYMEIQEIIQNT MREKQYLLIEDALKDLSHVLKTRYSEISELYLKISKLEISPNSQVGASVKIYYETNL NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaaactaaacaagccgtccatatccaccacttggtgtttgaaacgattttagggatt ttagagtttgaacgcttaaaaccccaaaaaataagcgtgaatgtggatcttttctacacg gaattacctaataaggcttatttagactacatggaaatccaagaaatcattcaaaacacc atgcgagaaaaacaataccttctcattgaagacgccctgaaagatttaagccatgtttta aaaacgcgctatagtgaaatctctgagctttatttgaaaatcagcaagttagaaatttct cccaattctcaagtgggggcgagcgtgaaaatttactatgaaaccaatctttag

DBGET integrated database retrieval system