Helicobacter pylori 83: HMPREF0462_0348 Help Entry HMPREF0462_0348   CDS       T01915                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism hpx  Helicobacter pylori 83 Pathway hpx00400   Phenylalanine, tyrosine and tryptophan biosynthesis hpx01100   Metabolic pathways hpx01110   Biosynthesis of secondary metabolites hpx01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:hpx00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     HMPREF0462_0348 Enzymes [BR:hpx01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      HMPREF0462_0348 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 DUF5580 Cys_rich_KTR Motif Other DBs NCBI-ProteinID:  AEE69953 UniProt:  F4D4G6 LinkDB All DBs Position 341103..341393 Genome browser AA seq 96 aa AA seqDB search MQNNLDSLLENLRAEIDVLDNELSDLLDKRLEIALKIALIKQENPIYCPKREQEILKRLS QRDFKHLNEEILTGFYAEVFKISRKFQENALKELKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcaaaataatttggatagtcttttagaaaatttaagggctgaaattgatgtgttggat aatgaattgagcgatcttttagacaaacgcttagaaatcgctttaaaaatcgctctcatc aaacaagaaaaccccatttattgccctaaaagagagcaagaaattttaaaacgactcagc caaagggatttcaagcatttgaatgaagagattcttacgggtttttatgcagaggttttt aagatttctagaaaatttcaagaaaacgccctaaaagagttaaaaaaataa

DBGET integrated database retrieval system