KEGG   Helicobacter pylori 83: HMPREF0462_1123Help
Entry
HMPREF0462_1123   CDS       T01915                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00010  Glycolysis / Gluconeogenesis
hpx00020  Citrate cycle (TCA cycle)
hpx00620  Pyruvate metabolism
hpx00640  Propanoate metabolism
hpx00650  Butanoate metabolism
hpx00680  Methane metabolism
hpx01100  Metabolic pathways
hpx01110  Biosynthesis of secondary metabolites
hpx01120  Microbial metabolism in diverse environments
hpx01130  Biosynthesis of antibiotics
hpx01200  Carbon metabolism
Module
hpx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0462_1123 (porA)
   00020 Citrate cycle (TCA cycle)
    HMPREF0462_1123 (porA)
   00620 Pyruvate metabolism
    HMPREF0462_1123 (porA)
   00640 Propanoate metabolism
    HMPREF0462_1123 (porA)
   00650 Butanoate metabolism
    HMPREF0462_1123 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    HMPREF0462_1123 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0462_1123 (porA)
Enzymes [BR:hpx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0462_1123 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AEE70727
UniProt: F4D293
LinkDB All DBs
Position
1127140..1128363
Genome map
AA seq 407 aa AA seqDB search
MAKNIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFKIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaatattgaactacaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggagtctgaacatgccgccatgagcgcatgcgtgggagctgcagcagctggtgga
agggtcagcactgcgactagctctcaaggtttggcgttaatggtagaagttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgtgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttgagtagggattctggctggataagt
ttatgcacatgcaaccctcaagaggcttatgatttcactttaatggcgtttaaaatcgca
gagcatcaaaaggtgcgtgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataagccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgacc
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtggcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgacc
atccattccttgcgccccttcccttatgaaagattggggcaggatttgaaaaaccttaaa
gctttagcgattttagataagagctctccagcgggtgctatgggggcgatgtttaatgaa
gtaacgagtgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagggatatgacaattgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system