KEGG   Helicobacter pylori 26695: HP0091Help
Entry
HP0091            CDS       T00008                                 

Definition
(RefSeq) type II restriction-modification system endonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hpy  Helicobacter pylori 26695
Brite
Enzymes [BR:hpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     HP0091
Prokaryotic defense system [BR:hpy02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    HP0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Chordopox_A15
Motif
Other DBs
NCBI-GeneID: 900289
NCBI-ProteinID: NP_206891
UniProt: O24917
LinkDB All DBs
Position
97256..98089
Genome map
AA seq 277 aa AA seqDB search
MKNHLPFDIFLKSLKTSNRTLDFFTDWQKCLKNKNKISIALNHLNFLLGKDTKELKNCIK
SLFKEYPKAFNVLNILIAVRDKKDIVLDANGNFYPLYSYFEDGEKVYEFIRQTGLERIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKVMENHLSGLFTNAQLNFKEQVEIREFEDLCQ
AFGDDIKKFDFVVCGKDKTYFIEANFYTISGSKLNEVARSYQDLALKFEAFPNYEFIWIT
DGIGWLDAKNKLQEAYKSVEIYNLSNVNDFISKAQKW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccatctgccttttgatatttttttaaaaagtcttaagacaagcaataggact
ttagattttttcaccgattggcaaaagtgcctcaaaaataaaaataaaataagcatcgct
ttaaaccacttgaattttttacttgggaaagatacaaaagagcttaaaaattgcattaag
agtctttttaaagaataccccaaagcttttaatgttttaaatattctcattgctgtgagg
gataaaaaggatatagtgcttgatgctaatggcaatttttaccccttatattcttatttt
gaagatggtgaaaaagtttatgagtttattcgtcaaacggggttggagcgaattttttgt
aacagaaatattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcgagaaaaaatcgcagcggaaaagttatggaaaatcatcttagcggtctttttacg
aacgctcaattaaattttaaagaacaagtagagattagagaatttgaggatttatgccaa
gcttttggagatgatattaaaaaatttgattttgttgtttgtggtaaagataaaacttat
tttatagaagctaatttttatactattagtgggagtaagcttaatgaagtcgcaagatcc
tatcaagacttagctttaaaatttgaagcattccccaattacgaatttatttggataacc
gatggcataggttggctggacgctaaaaacaaactccaagaagcttacaaatctgtagag
atctacaatttgagcaatgtaaatgattttatatcaaaggcacaaaaatggtaa

DBGET integrated database retrieval system