KEGG   Helicobacter pylori Aklavik117: HPAKL117_00655Help
Entry
HPAKL117_00655    CDS       T02352                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpya01100  Metabolic pathways
hpya01110  Biosynthesis of secondary metabolites
hpya01130  Biosynthesis of antibiotics
hpya01230  Biosynthesis of amino acids
hpya02024  Quorum sensing
Module
hpya_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hpya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAKL117_00655
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPAKL117_00655
Enzymes [BR:hpya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     HPAKL117_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AFX90548
UniProt: K7YBY8
LinkDB All DBs
Position
139924..141273
Genome map
AA seq 449 aa AA seqDB search
MSNTTWSPASWHSFKIEQHPTYKDKQELERVKKELRSYPPLVFAGEARNLQERLAQVIDN
KAFLLQGGDCAESFSQFSANRIKDMFKVMMQMAIVLTFAGSIPIVKVGRIAGQFAKPRSN
ATEILDNEEVLSYRGDIINGISKKEREPKPERMLKAYHQSVATLNLIRAFAQGGLANLEQ
VHRFNLDFVKNNDFGQKYQQIADRITQALGFMQACGVEIEKTPILREVEFYTSHEALLLH
YEEPLVRKDSLTNQFYDCSAHMLWIGERTRDPKGAHVEFLRGVCNPIGVKIGPNASVSEV
LELCDVLNPRNIKGRLNLIVRMGSKMIKERLPKLLQGVLKEKRHILWSIDPMHGNTVKTS
LGVKTRAFDSVLDEVKSFFEIHRAEGSLASGVHLEMTGENVTECIGGSQAITEEGLSCHY
YTQCDPRLNATQALELAFLIADMLKKQRA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacaacttggtcgcccgcttcatggcattcttttaagatagagcaacacccc
acttataaagataagcaagaattagaaagggtcaaaaaagaattgcgctcttaccctccc
ttagtgtttgctggggaagctaggaacttgcaagagcgattagcccaagtcattgacaat
aaggcgtttttgttgcaagggggcgattgcgcggagtcgttttctcaatttagcgctaac
aggattaaagacatgtttaaagtgatgatgcaaatggcgattgtcttaacttttgctggc
tctataccgattgtgaaagtggggcgcattgccgggcaatttgccaagcctcgctctaat
gcgactgaaatactagataacgaagaagtgctgagttatagaggggatattatcaatggg
atttctaaaaaagaaagagagccaaagcctgaaagaatgcttaaagcctaccatcaaagc
gtagcgactttaaaccttattagagcctttgctcaaggcgggttagcgaatttagagcaa
gtgcatcgtttcaatttggattttgtcaaaaacaacgattttgggcaaaaataccagcaa
atcgctgaccggatcacgcaagctttagggtttatgcaagcatgcggggtggagatagaa
aaaacgcctattcttagggaagtggaattttacaccagccacgaagcgttactgctccat
tatgaagagcctttggtgcgtaaggatagtttgactaaccagttttatgattgctccgcg
cacatgctgtggattggcgaaaggacaagagatcctaagggcgcgcatgtggagttttta
aggggggtttgtaaccctattggcgtgaaaatcgggcctaatgcgagcgtgagcgaagtg
ctagaattgtgcgatgttttaaacccgcgcaacattaaggggcgtttgaatttgatcgtg
cgcatgggttctaagatgattaaagagcgtttgcctaagcttttacaaggggtgttgaaa
gaaaaacgccatattttatggagcattgatcccatgcatggcaacacggttaaaaccagt
ttgggggttaaaacaagggcttttgatagcgtgttagatgaagtgaaaagcttttttgaa
atccatagggctgaagggagtttggcttcaggggttcatttggaaatgacaggtgagaat
gttacagaatgtatcggtggctcgcaagcgatcactgaagagggtttgagttgccattac
tatacgcaatgcgatccaaggctaaacgccacccaagccctagagctcgcttttttaatc
gctgacatgctcaaaaaacagcgcgcttaa

DBGET integrated database retrieval system