KEGG   Helicobacter pylori Aklavik117: HPAKL117_03495Help
Entry
HPAKL117_03495    CDS       T02352                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00473  D-Alanine metabolism
hpya00550  Peptidoglycan biosynthesis
hpya01100  Metabolic pathways
hpya01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPAKL117_03495 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPAKL117_03495 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HPAKL117_03495 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpya01011]
    HPAKL117_03495 (ddl)
Enzymes [BR:hpya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPAKL117_03495 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hpya01011]
 Precursor biosynthesis
  Amino acid ligase
   HPAKL117_03495 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_TupA GARS_A RimK VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: AFX91105
UniProt: K7Z4Z2
LinkDB All DBs
Structure
PDB: 

Position
732185..733228
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIALKEALKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLPPLILTHNGLLKNSFLGAKMIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKILDYVLLNEKNRTNALNLMGFNFPFIIKPSNAGSSLG
VNIVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYIEEPNKQEF
LDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGALIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggaattttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgatcgcgcttaaagaagcgctaaaggataggattaaatattttatttttttagatgaa
aaccatcatttttatttgattgaagaatctaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattaccccccctaatccttacgcataatggcttgcttaagaactcgttt
ttaggcgctaagatgatagaattgcctttagtgattaatcttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgttgagttataacaaatatttaaccaagctttacgccaaagactta
ggggtaaagattttagattatgttcttttgaatgaaaaaaaccgcactaacgctctaaat
ttgatgggctttaattttcctttcataatcaagcccagtaacgccgggagctctttaggg
gtgaatattgtgaaagaagaaaaagaattgatttacgctttagacggcgcgtttgaatat
tctaaagaggtcttaatagagcctttcattcagggagtgaaagaatacaatttagccggt
tgcaagatcaaaaaggatttttgtttttcttatattgaagagcctaacaagcaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaataaagcccctaaagcgaatctt
tctaacgccctagaagaacaattgaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgctcattcgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaatcctattcctggcagtttggccaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcgcaatcattacccaaaacccctaaaatccaaatcaaaaactcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system