KEGG   Helicobacter pylori Aklavik117: HPAKL117_05705Help
Entry
HPAKL117_05705    CDS       T02352                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hpya  Helicobacter pylori Aklavik117
Brite
KEGG Orthology (KO) [BR:hpya00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hpya03012]
    HPAKL117_05705
   03029 Mitochondrial biogenesis [BR:hpya03029]
    HPAKL117_05705
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpya04147]
    HPAKL117_05705
Translation factors [BR:hpya03012]
 Eukaryotic Type
  Elongation factors
   HPAKL117_05705
 Prokaryotic Type
   HPAKL117_05705
Mitochondrial biogenesis [BR:hpya03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HPAKL117_05705
Exosome [BR:hpya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HPAKL117_05705
  Exosomal proteins of breast cancer cells
   HPAKL117_05705
  Exosomal proteins of colorectal cancer cells
   HPAKL117_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFX91526
UniProt: K7YCP4
LinkDB All DBs
Position
complement(1204345..1205544)
Genome map
AA seq 399 aa AA seqDB search
MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGLAEMKDYDNIDNAPEEKERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPHIVVFLNKQDMVDDQELLELVEMEVRELLSAYEFPGDDTPIVAGSALRALE
EAKAGNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMPVEDVFSIAGRGTVVTGRIERG
VVKVGDEVEIVGIRATQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGMVLCK
PGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEGVEMVMPGD
NVKITVELISPVALELGTKFAIREGGRTVGAGVVSNIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttaacagaactaagccgcatgttaatattggaaccattgggcat
gtagaccatggtaaaacgactttgagtgcagcgatttcagcggtgctttctttgaaaggt
cttgcagaaatgaaagactatgataatattgataacgcccctgaagaaaaagaaagaggg
atcactatcgctacttctcacattgaatatgagactgaaaacagacactatgcgcatgtg
gattgcccaggacacgctgactatgtaaaaaacatgatcaccggtgcggcgcaaatggac
ggagcgattttggttgtttctgcagctgatggtcctatgcctcaaaccagggagcatatc
ttgttatctcgtcaagtaggcgtgcctcacatcgttgttttcttaaacaaacaagacatg
gtagatgaccaagaattgttagagttggtagaaatggaagtgcgcgaattgttgagcgcg
tatgaatttcctggcgatgacactcctatcgtagcgggttcagctttaagagctttagaa
gaagcaaaggctggcaatgtgggtgaatggggtgaaaaagtgcttaagctcatggctgaa
gtggatgcctatatccctactccagaaagagatactgaaaaaactttcttgatgccggtt
gaagatgtgttctctattgcgggtagaggaactgtggttacaggtaggattgaaagaggc
gtggtgaaagtgggcgatgaagtggaaatcgttggtatcagagctacacaaaaaacgact
gtaaccggtgtggaaatgtttagaaaagagttagaaaaaggtgaggccggcgataatgtg
ggcgtgcttttgagaggaactaaaaaagaagaagtagagcgcggtatggttttatgcaaa
ccaggctctatcactccgcacaagaaatttgagggagaaatttatgtcctttctaaagaa
gaaggcgggagacacactccattcttcaccaactaccgcccgcaattctatgtgcgcacg
actgatgtgactggctctatcacccttcctgaaggcgtagaaatggttatgcctggcgat
aatgttaaaatcaccgtagagttgattagccctgttgcgttagagttgggaactaaattt
gcgattcgtgaaggcggtagaaccgttggcgctggtgttgtgagcaatattattgaataa

DBGET integrated database retrieval system