KEGG   Helicobacter pylori oki128: HPOKI128_00525Help
Entry
HPOKI128_00525    CDS       T03724                                 

Definition
(GenBank) S-adenosylhomocysteine nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
hpyd  Helicobacter pylori oki128
Pathway
hpyd00130  Ubiquinone and other terpenoid-quinone biosynthesis
hpyd00270  Cysteine and methionine metabolism
hpyd01100  Metabolic pathways
hpyd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HPOKI128_00525
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HPOKI128_00525
Enzymes [BR:hpyd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     HPOKI128_00525
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     HPOKI128_00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: AHN37080
LinkDB All DBs
Structure
PDB: 

Position
complement(93898..94593)
Genome map
AA seq 231 aa AA seqDB search
MVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYRNKEIIVAYSKIGKVHSTL
TTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVALQLVQHDVDLSAFNHPLGFIPESAI
FIETSESLNALAKKVANEQHIVLKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASV
AFVCQKFGVPCCVLRSISDNADEEANMSFDAFLEKSAQTSAKFLKSMVDKL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaaaattggcattttaggggcgatgagagaagaaataacccctattttagaa
ttgtttggcgtggattttgaagagatccctttaggggggaatgttttccataagggcgtt
tatcgtaacaaggaaatcattgtcgcttatagcaagattggcaaggtgcattccacttta
accacaacgagcatgattttagcgtttggcgttcaaaaggtgctttttagcggggtggct
ggaagcttagtcaaagacttaaaaatcaatgatttgttagtggctcttcaattagtccag
catgatgtggatttgagcgcgtttaaccaccctttagggtttatcccagaaagcgcgatt
tttattgaaacgagcgaaagtttgaacgctttggctaaaaaagtcgctaatgagcaacac
atcgtgctcaaagaaggcgtcatcgcatcaggggatcagtttgtgcatagcaaagaaagg
aaagagtttttagtgagcgagtttaaggcgagcgcggtggaaatggagggggcgagcgtg
gcgtttgtgtgccaaaaatttggcgtgccatgctgtgtgctaaggagcattagcgataac
gctgatgaggaagctaacatgagctttgatgcgtttttagaaaaaagcgctcaaacttca
gcgaaattcttaaaaagcatggtagataagctttag

DBGET integrated database retrieval system