KEGG   Helicobacter pylori oki128: HPOKI128_01070Help
Entry
HPOKI128_01070    CDS       T03724                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hpyd  Helicobacter pylori oki128
Pathway
hpyd00061  Fatty acid biosynthesis
hpyd00780  Biotin metabolism
hpyd01100  Metabolic pathways
hpyd01130  Biosynthesis of antibiotics
hpyd01212  Fatty acid metabolism
Module
hpyd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hpyd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPOKI128_01070
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPOKI128_01070
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HPOKI128_01070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpyd01004]
    HPOKI128_01070
Enzymes [BR:hpyd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HPOKI128_01070
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HPOKI128_01070
Lipid biosynthesis proteins [BR:hpyd01004]
 Fatty acid synthase
  Component type
   HPOKI128_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase DUF1509
Motif
Other DBs
NCBI-ProteinID: AHN37177
LinkDB All DBs
Structure
PDB: 

Position
196044..196871
Genome map
AA seq 275 aa AA seqDB search
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYV
YELDVSQEEHFKPLYDSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISV
YSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHN
IRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVS
GEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaagggcttattgtaggggtggcaaacaataaatccatc
gcttatgggatcgctcaatcttgtttcaatcaaggggctactttggctttcacttatttg
aatgagagcttagaaaagcgcgtgaggcctatcgcgcaggaattgaatagcccctatgtg
tatgaattagatgtgagtcaagaagagcatttcaagccactatatgatagcgttaaaaag
gatttaggctcattggattttatcgttcatagcgtggcctttgcccctaaagaggcttta
gaggggagcttgttggaaacttctaaaagcgcgtttaacaccgctatggaaatttctgtt
tattctttaatagagctgacaaacaccctaaaacctttattaaataacggagcgtctgtt
ttgactttaagctatttaggcagcaccaaatacatggcgcattacaatgtgatggggttg
gctaaagcggccctagagagcgcagtgcgttatttagcggtggatttaggcaagcataac
ataagagtgaatgccctatcggccgggcctattaggacgctcgcttctagcgggatcgct
gattttaggatgattttaaaatggaatgaaatcaacgcccctttaagaaaaaatgtgagt
ttagaagaagtgggcaatgccgggatgtatttgctctctagcttgtctagtggggtgagt
ggggaagtgcattttgtggatgctggctatcatgttatgggcatgggggctgtggaagaa
aaggataataaagctacgctattatgggatttgcataaagaacaataa

DBGET integrated database retrieval system