KEGG   Helicobacter pylori oki154: HPOKI154_01050Help
Entry
HPOKI154_01050    CDS       T03725                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hpye  Helicobacter pylori oki154
Pathway
hpye00061  Fatty acid biosynthesis
hpye00780  Biotin metabolism
hpye01100  Metabolic pathways
hpye01130  Biosynthesis of antibiotics
hpye01212  Fatty acid metabolism
Module
hpye_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hpye00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPOKI154_01050
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPOKI154_01050
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HPOKI154_01050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpye01004]
    HPOKI154_01050
Enzymes [BR:hpye01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HPOKI154_01050
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HPOKI154_01050
Lipid biosynthesis proteins [BR:hpye01004]
 Fatty acid synthase
  Component type
   HPOKI154_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase DUF1509
Motif
Other DBs
NCBI-ProteinID: AHN38574
LinkDB All DBs
Structure
PDB: 

Position
195667..196494
Genome map
AA seq 275 aa AA seqDB search
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYV
YELDVSQEEHFKPLYDSVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISV
YSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHN
IRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSSGVS
GEVHFVDAGYHVMGMGAVEEKDNKATLSWDLHKEQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttaaaaggtaaaaaagggcttattgtaggggtggcaaacaataaatccatc
gcttatgggatcgctcaatcttgtttcaatcaaggggctactttggctttcacttatttg
aatgagagcttagaaaagcgcgtgaggcctatcgcacaggaattgaatagcccctatgtg
tatgaattagatgtgagccaagaagagcatttcaagccgctatatgatagcgttaaaaag
gatttaggctcattggattttatcgttcatagcgtggcctttgcccctaaagaggcttta
gaggggagcttgttagaaacttctaaaagcgcgtttaacaccgctatggaaatttctgtt
tattctttaatagagctgacaaacaccctaaaacctttattgaataacggagcgtctgtt
ttgactttaagctatttaggcagcaccaaatacatggcgcattacaatgtgatggggttg
gctaaagcggccctagagagcgcagtgcgttatttagcggtggatttaggcaagcataac
ataagagtgaatgccctatcggccgggcctattaggacgctcgcttctagcgggatcgct
gattttaggatgattttaaaatggaatgaaatcaacgcccctttaagaaaaaatgtgagt
ttagaagaagtgggcaatgctgggatgtatttgctctctagtttgtctagtggggtgagt
ggggaagtgcattttgtggatgctggctatcatgttatgggcatgggggctgtggaagaa
aaagataataaagctacgctatcgtgggatttgcataaagaacaataa

DBGET integrated database retrieval system