KEGG   Helicobacter pylori oki154: HPOKI154_05530Help
Entry
HPOKI154_05530    CDS       T03725                                 

Gene name
porA
Definition
(GenBank) 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpye  Helicobacter pylori oki154
Pathway
hpye00010  Glycolysis / Gluconeogenesis
hpye00020  Citrate cycle (TCA cycle)
hpye00620  Pyruvate metabolism
hpye00640  Propanoate metabolism
hpye00650  Butanoate metabolism
hpye00680  Methane metabolism
hpye01100  Metabolic pathways
hpye01110  Biosynthesis of secondary metabolites
hpye01120  Microbial metabolism in diverse environments
hpye01130  Biosynthesis of antibiotics
hpye01200  Carbon metabolism
Module
hpye_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPOKI154_05530 (porA)
   00020 Citrate cycle (TCA cycle)
    HPOKI154_05530 (porA)
   00620 Pyruvate metabolism
    HPOKI154_05530 (porA)
   00640 Propanoate metabolism
    HPOKI154_05530 (porA)
   00650 Butanoate metabolism
    HPOKI154_05530 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    HPOKI154_05530 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPOKI154_05530 (porA)
Enzymes [BR:hpye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPOKI154_05530 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AHN39349
LinkDB All DBs
Position
1114226..1115449
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNMASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPAIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaactacaagagatagaagtgtgggatggcaatatggctagttct
aacgctttaagacaggcccaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattatggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgcagcagctggtgga
agggtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttgagtagggattctggctggataagt
ttatgcacatgcaaccctcaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctgctattgtcaatcaagatggttttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataagccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgacc
aaaactttccagctagaagacgctgaaatcgctatttttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgacc
atccattccttgcgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagataagagctctccagcgggcgctatgggggcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcgc
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system