KEGG   Helicobacter pylori oki422: HPOKI422_00405Help
Entry
HPOKI422_00405    CDS       T03726                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hpyf  Helicobacter pylori oki422
Pathway
hpyf00061  Fatty acid biosynthesis
hpyf00780  Biotin metabolism
hpyf01100  Metabolic pathways
hpyf01212  Fatty acid metabolism
Module
hpyf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hpyf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPOKI422_00405
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HPOKI422_00405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpyf01004]
    HPOKI422_00405
Enzymes [BR:hpyf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HPOKI422_00405
Lipid biosynthesis proteins [BR:hpyf01004]
 Fatty acid synthase
  Component type
   HPOKI422_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AHN39890
LinkDB All DBs
Structure
PDB: 

Position
73652..74131
Genome map
AA seq 159 aa AA seqDB search
MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRIIELQANQKIVAYKNITFNEDVFNGHFP
NKPIFPGVLIVEGMAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE
YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaagccatcaaaacttacaatctcaattttttatagagcatatcttacagatt
ttacctcaccgctatcccatgctcttagtggatagaattatagagttacaagccaatcaa
aaaattgtcgcttataagaatatcacttttaatgaagatgtgtttaacgggcatttccct
aataagcccattttcccgggcgttttgatcgtagagggcatggcgcaaacgggagggttt
ttagccttcactagcttgtgggggtttgaccctgaaatagccaaaacaaaaatcgtgtat
ttcatgacgattgataaggttaaattccgcattcctgtaaccccaggcgacagattggaa
taccatttagaagtcttaaagcataagggcatgatctggcaagtgggcggcacggctcaa
gtggatggcaaagtggtcgctgaagccgaattaaaagccatgatcgcagagagagattag

DBGET integrated database retrieval system