KEGG   Helicobacter pylori oki422: HPOKI422_04020Help
Entry
HPOKI422_04020    CDS       T03726                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hpyf  Helicobacter pylori oki422
Pathway
hpyf00550  Peptidoglycan biosynthesis
hpyf01100  Metabolic pathways
hpyf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hpyf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPOKI422_04020
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HPOKI422_04020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hpyf01003]
    HPOKI422_04020
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpyf01011]
    HPOKI422_04020
Enzymes [BR:hpyf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HPOKI422_04020
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HPOKI422_04020
Glycosyltransferases [BR:hpyf01003]
 Polysaccharide
  Bacterial polysaccharide
   HPOKI422_04020
Peptidoglycan biosynthesis and degradation proteins [BR:hpyf01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HPOKI422_04020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Lipoprotein_1
Motif
Other DBs
NCBI-ProteinID: AHN40546
LinkDB All DBs
Position
819017..820996
Genome map
AA seq 659 aa AA seqDB search
MLKKIFYGFIVLFLIVIWLLAILIAQVWVNTNKDIAKIKDYRPSVASQILDRKGRLIANI
YDKEFRFYARFEEIPPRFIESLLAVEDTLFFEHGGINLDAIMRAMIKNAKSGRYTEGGST
LTQQLVKNMVLTREKTLTRKLKEAIISIRIEKVLSKEEILERYLNQTFFGHGYYGVKTAS
LGYFKKPLDKLTLKEIAMLVALPRAPSFYDPTKNLEFSLSRANDILRRLYSLGWISSNEL
KGALNEVPIVYNQTSTQNIAPYVVDEVLKQLDQLDGLKTQGYTIKLTIDLDYQRLALESL
RFGHQKILEKIAKEKPKTNASNENEDNLNASMIVTDTSTGKILALVGGIDYKKSAFNRAT
QAKRQFGSAIKPFVYQIAFDNGYSTTSKIPDTARNFENGNYSKNSAQNHAWHPSNYSRKF
LGLVTLQEALSHSLNLATINLSDQLGFEKIYQSLSDMGFKNLPKDLSIVLGSFAISPIDA
AEKYSLFSNYGTMLKPMLIESITDQQNNIKTFTPIETKKITSKEQAFLTLSVLMNAVENG
TGNLARIKGLEIAGKTGTSNNNIDAWFIGFTPTLQSVIWFGRDDNTPISKGATGGVVSAP
VYSYFMHNILAIEPSLKRKFDVPKGLRKEIVDKIPYYSTPNSITPTPKRTDDSEERLLF
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaagattttttatggttttatcgttttatttttgattgtcatatggttgtta
gccattcttatcgctcaagtttgggtgaataccaataaggatattgctaaaattaaagat
tatcgcccaagcgtcgcttcacagattttagaccgaaaagggcgtttgatcgctaatatc
tatgataaggaattccgtttttatgcgcgttttgaagaaatccccccacgatttattgaa
agccttttagcggtagaagacaccctcttttttgaacatggggggatcaatttagacgct
atcatgcgcgctatgattaaaaacgctaaaagcggtcgttacaccgaggggggtagcacc
ctaacccaacaactcgttaaaaacatggtgctcacacgagaaaaaaccctaaccagaaag
ctcaaagaagctatcatttccatacgcattgaaaaagtcttaagcaaagaagagatttta
gagcgttatttgaaccaaactttttttgggcatgggtattatggcgtgaaaaccgcaagt
ttagggtattttaaaaaaccccttgacaaactcacgcttaaagaaatcgccatgctagtc
gccttgcctagggctccaagtttttatgaccctaccaaaaatttagaattttcactctct
agggctaatgatattttaaggcggttgtattctttaggctggatttcttctaacgagctc
aaaggcgctctcaatgaagtgccaatcgtctataaccaaacttccacgcaaaatatcgct
ccctatgtggtggatgaagtgttgaagcaattggatcaattagacgggttaaaaactcaa
ggctataccataaagctcacgatagatttggattaccaacgcttagcgttagagtccttg
cgttttgggcatcaaaaaatcttagaaaaaatcgctaaagaaaagccaaaaactaacgcc
tctaatgaaaatgaagacaacttaaacgctagcatgatcgttacagacacgagcaccggt
aagattttagctttagtgggggggattgattataaaaaaagcgctttcaatcgtgccacg
caagccaaacggcagtttgggagtgcgataaagccttttgtgtatcagatcgcttttgat
aatggctattccaccacttccaaaatccctgataccgcgcgaaactttgaaaatggcaat
tatagtaaaaacagtgcacaaaaccacgcatggcaccccagcaattattctcgcaagttt
ttagggcttgtaaccttgcaagaagctttgagccattcgttaaatctagccacgatcaat
ttaagcgatcagcttggctttgaaaaaatttatcaatctttaagcgatatggggtttaaa
aaccttcctaaagacttgtctatcgtgttagggagctttgctatctcacccattgatgcg
gctgaaaagtattctttattttctaattacggcaccatgctcaaacccatgctcattgaa
agcattactgatcagcaaaacaatatcaaaactttcacgcccattgaaaccaaaaagatc
acctccaaagaacaggcttttttaaccctttcagtgctgatgaatgcggtagaaaacggc
acagggaatttggctcgcattaaaggtttagaaattgccggtaaaaccgggacttctaac
aacaatattgacgcttggttcattggctttacccccaccttacaaagtgtgatctggttt
gggagggacgataacacgcctattagtaaaggagcgacaggaggcgttgtgagcgcacct
gtgtattcgtatttcatgcacaacattttagcgattgaaccttctttaaaaagaaagttt
gatgtccccaaaggcttgcgtaaagaaatcgtggataaaatcccctactattcaaccccc
aattccatcacccccacccccaaaagaacagacgatagcgaggaacgcttgttgttctaa

DBGET integrated database retrieval system