KEGG   Helicobacter pylori oki673: HPOKI673_00520Help
Entry
HPOKI673_00520    CDS       T03727                                 

Definition
(GenBank) S-adenosylhomocysteine nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
hpyg  Helicobacter pylori oki673
Pathway
hpyg00130  Ubiquinone and other terpenoid-quinone biosynthesis
hpyg00270  Cysteine and methionine metabolism
hpyg01100  Metabolic pathways
hpyg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HPOKI673_00520
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HPOKI673_00520
Enzymes [BR:hpyg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     HPOKI673_00520
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     HPOKI673_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: AHN41385
UniProt: X2I9V1
LinkDB All DBs
Structure
PDB: 

Position
complement(93905..94600)
Genome map
AA seq 231 aa AA seqDB search
MVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYRNKEIIVAYSKIGKVHSTL
TTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVALQLVQHDVDLSAFNHPLGFIPESAI
FIETSESLNALAKKVANEQHIALKEGVIASGDQFVHSQERKEFLVSEFKASAVEMEGASV
AFVCQKFGVPCCVLRSISDNADEEANMSFDAFLEKSAQTSAKFLKSMVDKL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaaaattggcattttaggggcgatgagagaagaaataacccctattttagaa
ttgtttggcgtggattttgaagagatccctttaggggggaatgttttccataagggcgtt
tatcgtaacaaggaaatcattgtcgcttatagcaagattggcaaggtgcattccacttta
accacaacgagcatgattttagcgtttggcgttcaaaaggtgctttttagcggggtagct
ggaagcttagtcaaagacttaaaaatcaatgatttgttagtggctcttcaattagtccag
catgatgtggatttgagcgcgtttaaccaccctttagggttcatcccagaaagtgcgatt
tttattgaaacgagcgaaagtttaaacgctttagctaaaaaagtcgctaacgagcaacac
atcgcgctcaaagaaggcgtcatcgcatcaggggatcagtttgtgcatagccaagaaagg
aaagagtttttagtgagcgagtttaaggcgagcgcggtggaaatggagggggcgagcgtg
gcgtttgtgtgccaaaaatttggcgtgccatgctgtgtgctaaggagcattagcgataac
gctgatgaggaagctaacatgagctttgatgcgtttttagaaaaaagcgctcaaacttca
gcgaaattcttaaaaagcatggtggataagctttag

DBGET integrated database retrieval system