KEGG   Helicobacter pylori oki673: HPOKI673_05375Help
Entry
HPOKI673_05375    CDS       T03727                                 

Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
hpyg  Helicobacter pylori oki673
Pathway
hpyg00061  Fatty acid biosynthesis
hpyg00620  Pyruvate metabolism
hpyg00640  Propanoate metabolism
hpyg01100  Metabolic pathways
hpyg01110  Biosynthesis of secondary metabolites
hpyg01120  Microbial metabolism in diverse environments
hpyg01130  Biosynthesis of antibiotics
hpyg01200  Carbon metabolism
hpyg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hpyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOKI673_05375
   00640 Propanoate metabolism
    HPOKI673_05375
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HPOKI673_05375
Enzymes [BR:hpyg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     HPOKI673_05375
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HPOKI673_05375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_C Biotin_carb_N Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_ST ATPgrasp_Ter ATP-grasp_5 LAL_C2
Motif
Other DBs
NCBI-ProteinID: AHN42224
UniProt: X2I9W4
LinkDB All DBs
Position
1083925..1085292
Genome map
AA seq 455 aa AA seqDB search
MNKENKKVEKKELSRILIANRGEIALRAIQTIQEMGKESIAIYSIADKDAHYLNTANAKV
CIGGAKSSESYLNIPAIISAAELFEADAIFPGYGFLSENQNFVEICSHHSLEFIGPSAKV
MALMSDKSKAKSVMKEAGMPVIEGSDGLLKSYQEAEEIADKIGYPVIIKAAAGGGGRGMR
VVGDKSKLKNLYLAAETEALSAFGDGSVYLEKFINKPKHIEVQILADKHGNVIHVGERDC
SVQRRQQKLIEETPAVVLEESVRKRLLETAIKAAKYIGYVGAGTFEFLLDSNMKDFYFME
MNTRLQVEHTISEMVSGLNLIEWMIKIAQGEELPKQESFSLKGHAIECRITAEDPKKFYP
SPGKITEWIAPGGVNVRLDSHAHAHYVVPTHYDSMIGKLIVWGENRERAIAKMKRALKEF
KVEGIKTTIPFHLEMLENADFRQAKIHTKYLEENF
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaaaataaaaaagtagaaaaaaaagagctttcgcgcattttgatcgctaat
agaggcgagatcgctttaagagcgatccaaaccattcaagaaatgggtaaagaatccata
gccatttattctatcgctgacaaggacgcccactatctcaatacggctaacgcaaaagtg
tgtatagggggggcaaaatccagcgagagttacttgaatattcctgcgatcattagcgcg
gcggaattgtttgaagcggatgcgattttccctgggtatgggtttttgagcgagaatcag
aattttgtagagatttgctcgcaccattctttagaatttattggcccgagcgcgaaagtc
atggctttaatgagcgataaatccaaagccaaaagcgtgatgaaagaagccggcatgcct
gtgattgagggcagtgatgggttgcttaaaagctatcaagaagctgaagaaatcgctgat
aagatcggctaccctgtcatcatcaaagcggccgctggtgggggcgggagaggcatgcgc
gtcgtaggagataaatccaagcttaaaaacctttatctagccgcagaaacggaagctttg
agtgcgtttggcgatgggagcgtgtatttagaaaaattcatcaacaagcctaagcacatt
gaagtccaaattctagccgataagcatggcaatgtcattcatgtgggcgaaagggattgt
tcggtgcaaagacgccagcaaaagctcattgaagaaaccccggcagtggttttagaagag
agcgttcgtaagcgtttgttagaaacagcgatcaaggccgctaaatatatcggctatgtg
ggggctgggacttttgaatttttgctcgattctaacatgaaagatttttatttcatggag
atgaacactcgtttgcaagtggaacacaccattagcgaaatggtgagcgggttaaacctc
attgaatggatgattaaaatcgctcaaggcgaagaattgcccaagcaagaaagcttttcc
ctcaaagggcatgcgatagaatgtaggatcactgcagaagatcctaaaaaattctaccca
agcccgggtaaaatcaccgaatggatcgcccctggtggggtgaacgtgcgccttgattcg
catgcgcatgcccattatgtcgtgcctacgcactatgattctatgattggcaagctcatt
gtgtggggtgaaaacagagaaagagcgatcgctaagatgaaaagggctttaaaggaattt
aaagtagaaggcattaaaacgaccattcctttccaccttgaaatgcttgaaaatgcggat
ttcaggcaagcaaaaatccacacgaagtatttggaagaaaatttttaa

DBGET integrated database retrieval system