KEGG   Helicobacter pylori UM037: K750_07885Help
Entry
K750_07885        CDS       T02659                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hpyi  Helicobacter pylori UM037
Pathway
hpyi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpyi01100  Metabolic pathways
hpyi01110  Biosynthesis of secondary metabolites
hpyi01130  Biosynthesis of antibiotics
hpyi01230  Biosynthesis of amino acids
hpyi02024  Quorum sensing
Module
hpyi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hpyi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    K750_07885
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    K750_07885
Enzymes [BR:hpyi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     K750_07885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AGL70499
UniProt: R4QAW7
LinkDB All DBs
Position
17236..18585
Genome map
AA seq 449 aa AA seqDB search
MSNTTWSPTSWHSFKIEQHPTYKDKQELERVKKELHSYPPLVFAGEARNLQERLAQVIDN
KAFLLQGGDCAESFSQFSANRIRDMFKVMMQMAIVLTFAGSIPIVKVGRIAGQFAKPRSN
ATEMLDNEEVLSYRGDIINGISKKEREPNPERMLKAYHQSVATLNLIRAFAQGGLADLEQ
VHRFNLDFVKNNDFGQKYQQIADRITQALGFMQACGVEIEKTPILREVEFYTSHEALLLH
YEEPLVRKDSLTNQFYDCSAHMLWIGERTRDPKGAHVEFLRGVCNPIGVKIGPNASVSEV
LELCDVLNPRNIKGRLNLIVRMGSKMIKERLPKLLQGVLKEKRHILWSIDPMHGNTVKTS
LGVKTRAFDSVLDEVKSFFEIHRAEGSLASGVHLEMTGENVTECIGGSQAITEEGLSCHY
YTQCDPRLNATQALELAFLIADMLKKQRA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacaacttggtcgcccacttcatggcattcttttaagatagagcaacacccc
acttacaaagataagcaagaattagaaagggtcaaaaaagaattgcactcctaccctccc
ttagtgtttgctggcgaagcgaggaatttgcaagagcgtttagcccaagtcattgacaat
aaggcgtttttgttgcaagggggcgattgtgcggagtcgttttctcaatttagcgctaac
cggattagagacatgtttaaagtgatgatgcaaatggcgattgtcttaacttttgctggc
tctataccgattgtgaaagtggggcgcattgccgggcaatttgccaagcctcgctccaat
gcgactgaaatgctggataatgaagaagtgttgagttacagaggggatattatcaatggg
atttccaaaaaagaaagagaaccaaatcctgaaagaatgcttaaagcctaccatcaaagc
gtagcgactttaaaccttatcagagcttttgcccaaggcgggttagcggatttggaacaa
gtgcatcgtttcaatttggattttgtcaaaaacaacgactttgggcaaaaataccagcaa
atcgctgaccggatcacgcaagctttagggttcatgcaagcgtgtggggtggagatagaa
aaaacgcctattcttagggaagtggaattttacaccagccacgaagcgttactgctccat
tatgaagagcctttggtgcgtaaggatagtttgactaaccagttttatgactgctctgcg
cacatgctgtggattggcgaaaggacaagagatcctaagggtgcgcatgtggagttttta
aggggggtttgtaaccctattggcgtgaaaattgggcctaatgcgagcgtgagcgaagtg
ttagaattgtgcgatgttttaaacccgcgcaacattaaggggcgtttgaatttgatcgtg
cgcatgggttctaagatgattaaagagcgcttgcctaagcttttacaaggggtgttgaaa
gaaaaacgccatattttatggagcattgatcccatgcatggcaacacggttaaaaccagt
ttgggggttaaaacaagggcttttgatagcgtgttggatgaagtgaaaagcttttttgaa
atccatagggctgaagggagtttggcttcaggggttcatttggaaatgacaggtgagaat
gttacagaatgtatcggtggctcgcaagcgatcactgaagagggtttgagctgccattac
tacacgcaatgcgatccaagactaaacgccactcaagccttagaacttgcttttttaatt
gctgacatgcttaaaaaacaacgcgcttga

DBGET integrated database retrieval system