KEGG   Helicobacter pylori oki898: HPOKI898_03360Help
Entry
HPOKI898_03360    CDS       T03729                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpyj  Helicobacter pylori oki898
Pathway
hpyj00473  D-Alanine metabolism
hpyj00550  Peptidoglycan biosynthesis
hpyj01100  Metabolic pathways
hpyj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpyj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPOKI898_03360
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPOKI898_03360
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HPOKI898_03360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpyj01011]
    HPOKI898_03360
Enzymes [BR:hpyj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPOKI898_03360
Peptidoglycan biosynthesis and degradation proteins [BR:hpyj01011]
 Precursor biosynthesis
  Amino acid ligase
   HPOKI898_03360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_TupA RimK VitD-bind_III ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHN44788
LinkDB All DBs
Structure
PDB: 

Position
complement(660497..661567)
Genome map
AA seq 356 aa AA seqDB search
MQSFLGSLIVEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESN
MHSKYFAQIKEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEF
YRIAFIGPRIEASVLSYSKYLTKLYAKDLGVKTLDYVLLNEKNRANALDLIGFNFPFIVK
PSNAGSSLGVSVVKEEKELIYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSY
IEEPNKQEFLDFKQKYLDFSRTKAPKANLSNAIEEQLKENFKKLYNDLFDGAIIRCDFFV
IENEVYLNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIPIKNSYLLQIQKNK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatcgtttttagggagtttgatcgtggagttttgcgttttatttggtggggcgagt
tttgagcatgaaatcagcattgtgagtgcgatcgcgcttaaaggagtgttaaaagacagg
attaaatattttatttttttagatgaaaaccatcatttttatttgattgaagaatccaac
atgcattcaaaatacttcgctcaaatcaaagaaaaaaaattaccccccctaatcctcaca
cacaatggcttgcttaaaaactcgtttttaggggctaagattatagaattgcctttagtg
atcaatctcgtgcatgggggcgatggcgaagacgggaaattagcgagcttgttagaattt
tatcgtatcgcttttataggccctaggattgaagcgagcgtgttgagttatagcaaatat
ttaaccaagctttatgccaaagatttaggggtgaagactttagattatgttcttttgaat
gaaaaaaaccgcgctaacgccttggatttgattgggtttaatttccctttcattgtgaaa
cccagtaacgccggaagctctttaggagtgagcgttgtgaaagaagaaaaagaattgatt
tacgctttagacagtgcgtttgaatattctaaagaagttttaatagagcctttcattcag
ggcgtgaaagaatacaatttagccggctgtaagatcaaaaaggatttttgtttttcctat
attgaagagcctaacaaacaggaatttttagatttcaaacaaaaatatttggatttttca
cgcaccaaagcccctaaagcgaatctttctaacgccatagaagagcaattgaaagaaaac
tttaaaaaactctataacgatttgtttgatggcgcgatcattcgttgcgatttttttgtc
atagaaaatgaagtgtatcttaatgagatcaatcccattcctggcagtttggccaattat
ttgtttgatgattttaaaacaacgctagaaaatttagcgcaatcattacccaaaacccct
aaaatcccaatcaaaaactcttatttgttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system