KEGG   Helicobacter pylori oki898: HPOKI898_04915Help
Entry
HPOKI898_04915    CDS       T03729                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hpyj  Helicobacter pylori oki898
Pathway
hpyj00473  D-Alanine metabolism
hpyj01100  Metabolic pathways
hpyj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpyj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPOKI898_04915
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HPOKI898_04915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpyj01011]
    HPOKI898_04915
Enzymes [BR:hpyj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPOKI898_04915
Peptidoglycan biosynthesis and degradation proteins [BR:hpyj01011]
 Precursor biosynthesis
  Racemase
   HPOKI898_04915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHN45064
LinkDB All DBs
Position
complement(1006550..1007683)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNTVSLRHNFSAVKSIVPKDAHIMAVVKANAYGVGAIKASEIFLQEGANYL
GVAALDEALELRSHFPKTPILILGYSPNANASMLVDNDLSAMVFSLEQAEVFSQMALKAK
KRLKIHLKIDTGMHRLGLEPNFKSIETIKKIRALKGLEIEGIFTHLSNADAKIKTHAKNQ
MKAFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNGNENRLLNLYRPGIMLYGFYPSNEMK
ESCPTILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLARALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNNIQAKEGDEVILFGDKSARANDASEIAALLNTI
AYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaataccgtttctctaaggcataattttagc
gcagtcaaaagcattgtccctaaagacgcccacatcatggcggttgtcaaggcgaacgct
tacggggtaggggcgatcaaagcgagtgaaatttttttacaagaaggggctaattattta
ggggtagcggccttagatgaagctttagagttgcgttctcatttccctaaaacccccatt
ttgatcttaggttatagccctaacgctaacgcttccatgctagttgataacgatttgagc
gctatggtttttagccttgaacaagcggaagttttttctcaaatggctttaaaagccaaa
aaacgcttaaaaattcatcttaaaattgataccggcatgcaccgcttgggcttagagcct
aattttaaaagcatagaaactattaaaaaaatccgcgctttaaaaggcttggaaatagag
gggatattcacgcatttaagcaacgctgatgctaagattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagagcagcttttggatcaaaaaatagagttccaatac
cgccatgcctacaattctgccggcatcctttctttgtgtaacgggaatgaaaatcgtttg
ttgaatctctatcgcccaggtatcatgctctatggtttttacccctctaatgaaatgaaa
gaatcatgcccaaccatcttgaaaaatgttatcagtttaaaagctcaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttacaccaatgaagag
actttagtgggtgttttagctctagggtatgcagacgggttagcgcgcgctttaggcaat
cgcattcaagtagcgatcaacaaccaactagcccctcttattggcaaggtgtgcatggat
cagtgctttgtcaaactcaataatattcaagccaaagagggcgatgaggtcatcttgttt
ggggataaaagcgctagagctaatgacgcaagcgagatcgctgcgcttttaaacaccatt
gcttatgaaactatcagcactttgtccaaacgcttggagcgcgtctatatttaa

DBGET integrated database retrieval system