Helicobacter pylori oki898: HPOKI898_05840 Help Entry HPOKI898_05840    CDS       T03729                                  Symbol porD Name (GenBank) ferredoxin   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism hpyj  Helicobacter pylori oki898 Pathway hpyj00010   Glycolysis / Gluconeogenesis hpyj00020   Citrate cycle (TCA cycle) hpyj00620   Pyruvate metabolism hpyj00640   Propanoate metabolism hpyj00650   Butanoate metabolism hpyj00680   Methane metabolism hpyj01100   Metabolic pathways hpyj01110   Biosynthesis of secondary metabolites hpyj01120   Microbial metabolism in diverse environments hpyj01200   Carbon metabolism hpyj01210   2-Oxocarboxylic acid metabolism Module hpyj_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:hpyj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     HPOKI898_05840 (porD)    00020 Citrate cycle (TCA cycle)     HPOKI898_05840 (porD)    00620 Pyruvate metabolism     HPOKI898_05840 (porD)    00640 Propanoate metabolism     HPOKI898_05840 (porD)    00650 Butanoate metabolism     HPOKI898_05840 (porD)   09102 Energy metabolism    00680 Methane metabolism     HPOKI898_05840 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     HPOKI898_05840 (porD) Enzymes [BR:hpyj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      HPOKI898_05840 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_10 Fer4_21 Fer4 Fer4_7 Fer4_9 Fer4_6 Fer4_2 Fer4_8 Fer4_17 Fer4_15 Fer4_16 Fer4_13 Fer4_4 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  AHN45214 LinkDB All DBs Position 1188186..1188578 Genome browser AA seq 130 aa AA seqDB search MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ WPQKQEKKKS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaagaacgcg caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagttacttcacc acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgcatcaat tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaaatta aagggcgtggattattctcattgtaagggctgtggcgtgtgcgtggatgtctgccccact aaccctaaatcgctatggatgtttgaagaacaaattgagcctgccaccgctctcactcaa tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system