KEGG   Helicobacter pylori Aklavik86: HPAKL86_00535Help
Entry
HPAKL86_00535     CDS       T02353                                 

Definition
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPAKL86_00535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpyk01007]
    HPAKL86_00535
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpyk03016]
    HPAKL86_00535
Enzymes [BR:hpyk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     HPAKL86_00535
Amino acid related enzymes [BR:hpyk01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   HPAKL86_00535
Transfer RNA biogenesis [BR:hpyk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HPAKL86_00535
 Prokaryotic type
    HPAKL86_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N SPATA1_C Surfac_D-trimer DUF1664
Motif
Other DBs
NCBI-ProteinID: AFX89135
UniProt: K7YZJ1
LinkDB All DBs
Position
104088..105335
Genome map
AA seq 415 aa AA seqDB search
MIDKKLLLQDFEMVALSLKKRNNAMDDELERLREVITHYKKQLIELEGLQAFQNKVSKEF
GIKMAQKVDTSDLKKELENNKIKLNELSKSVGELEQQIDLKLSIIPNLVDEKTPLGASEE
DNIEIKKILTPRNFTFKPKEHFELAQQNGWIDFESGVKLAKSRFSVIRGFGAKIYRALIH
LMLDFNEKNGFEIIYTPALVNEKMLFGTGQLPKFKEDVFKIENENLYLIPTAEVTLTNLY
NDTIVSVEKLPIKMTAHTPCFRSEAGSAGKDTRGMIRQHQFDKVELVAITHPKESDVMQE
HMLESASEILKALELPHRFVQLCSADLGFSASNTIDIEVWLPGQNCYREISSVSNTRDFQ
ARRTKIRFKENQKNQLAHTLNGSSLAVGRTMVALMENHQQADGSIHIPKALEKYL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgattgataaaaaacttttattgcaagattttgagatggtggctctttctttaaaaaag
cgtaataatgcgatggatgatgagttggagcgcttgcgcgaagtcatcacgcattataaa
aagcagctcattgaattagaaggcttgcaagcctttcaaaacaaggtttctaaagaattt
ggtatcaaaatggctcaaaaagtggatacaagcgatcttaaaaaagagctagaaaacaat
aaaatcaaactgaatgagctttccaaaagcgtgggcgaattggagcaacaaatagattta
aagctttcaataatccctaatctggtggatgaaaaaacccctttaggtgcaagcgaagaa
gataacatagagattaaaaaaatcttaacccctagaaatttcactttcaaacccaaagag
cattttgaactcgctcaacaaaatggctggattgattttgaaagcggtgtgaaactcgct
aaaagccgtttttctgtcattaggggttttggggctaaaatttatcgcgcgctcatccat
ttgatgttggattttaatgaaaaaaatggctttgaaatcatctacacgccggcgttagtg
aatgaaaaaatgctttttgggaccgggcaattgcccaaattcaaagaagatgttttcaaa
atagaaaatgaaaatttgtatctgatccccaccgctgaagtaacgctcactaatctatac
aacgacacgattgttagcgttgaaaaactccctattaaaatgaccgcgcacacgccttgt
tttaggagcgaagcagggagtgcgggcaaggatacaagagggatgataagacagcaccag
tttgataaagtggagctagtggctatcacgcaccctaaagaaagcgatgttatgcaagag
catatgctagagagtgccagcgaaattttaaaggctttggaattaccgcaccggtttgtg
caattgtgtagcgcggatttaggctttagcgcaagcaacacgatagatattgaagtgtgg
ctgcccgggcaaaattgctaccgagaaatcagctcggtgtctaacacgagggattttcaa
gccaggcgcacgaaaatccgcttcaaagaaaatcaaaaaaaccagttagcgcacacctta
aacggctcttctttggcggtaggcaggacgatggtcgctttaatggaaaaccaccagcaa
gcggatgggagcatccacattcctaaggcgttagaaaaatacctttaa

DBGET integrated database retrieval system