KEGG   Helicobacter pylori Aklavik86: HPAKL86_02370Help
Entry
HPAKL86_02370     CDS       T02353                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00473  D-Alanine metabolism
hpyk01100  Metabolic pathways
hpyk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPAKL86_02370
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HPAKL86_02370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpyk01011]
    HPAKL86_02370
Enzymes [BR:hpyk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPAKL86_02370
Peptidoglycan biosynthesis and degradation proteins [BR:hpyk01011]
 Precursor biosynthesis
  Racemase
   HPAKL86_02370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFX89487
UniProt: K7YMA1
LinkDB All DBs
Position
complement(481259..482392)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNSASLRHNFNAVKSIVPKDAHIMAVVKANAYGVGAIKASKIFLQEGANYL
GVATLDEALELRSHFSKTPILILGYSPNANAFMLADNDLSAMIFSLEQAEIFSQMALKSQ
KRLKVHLKIDTGMHRLGLEPNFKSIETIKKIRALKGLEVEGIFTHLSNADSNIKTHAKNQ
METFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNGNENRLLNLYRPGIMLYGFYPSDEMK
KSCPTILKNVVSLKAQIVQIRSVKKGEFIGYGKHFYTNEETLVGTLALGYADGLVRDLGN
RIQVAINNQLAPLIGKVCMDQCFVKLNNIEAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagagcgagttttgtagaagtgaatagcgcttctttaaggcataattttaac
gcagtcaaaagcattgtccctaaagacgcccatatcatggcagttgtcaaggcgaatgct
tatggggtgggagccataaaagcgagcaaaattttcttacaagaaggggctaattattta
ggggtagcaaccttagatgaagctttagagttgcgctctcatttttctaaaacccctatt
ttgattttaggctatagccctaatgctaacgctttcatgctggctgataacgatttgagc
gctatgatttttagccttgaacaagcggaaattttttctcaaatggctttaaagtctcaa
aaacgcttaaaagtgcatctcaagattgataccggcatgcaccgcttgggtttagagcct
aattttaaaagcatagaaaccattaaaaaaatccgcgctttaaaaggcttggaggtggaa
gggatattcacgcatttaagcaacgctgattccaacattaaaacccatgctaaaaaccaa
atggaaacctttaacgcttttttagagcagcttttggatcaaaaaatagagtttcaatac
cgccatgcctacaattccgccggcatcctttctttgtgtaacgggaatgaaaatcgtttg
ttaaacctttatcgcccagggatcatgctctatggtttttacccttctgatgaaatgaaa
aaatcatgcccaaccattttaaaaaatgttgtcagcctgaaagcccaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcaagcatttttacacgaatgaagag
actttagtcggcactctggctttggggtatgcagacgggttggtgcgcgatttaggcaat
cgcattcaagtcgcgatcaataaccagttagcccctcttattggcaaagtgtgcatggat
caatgttttgtcaagctcaataatattgaagccaaagaaggcgatgaggtcatcttattt
ggggataaaagcgctaaggctaacgatgcaagcgaaatcgctgcgcttttaaacaccatt
ccttatgaaactatcagcaccctatccaaacgcttggagcgcgtttatgtgtga

DBGET integrated database retrieval system