KEGG   Helicobacter pylori OK310: HPOK310_0104Help
Entry
HPOK310_0104      CDS       T02542                                 

Definition
(GenBank) Type II restriction enzyme protein
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hpyl  Helicobacter pylori OK310
Brite
Enzymes [BR:hpyl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     HPOK310_0104
Prokaryotic defense system [BR:hpyl02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    HPOK310_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Chordopox_A15 DUF3227
Motif
Other DBs
NCBI-ProteinID: BAM97532
UniProt: M4ZLL5
LinkDB All DBs
Position
104541..105371
Genome map
AA seq 276 aa AA seqDB search
MKSHLPFDIFLQSLKISNRALGFFTDWQKCLKNRNEISIALNHLNFLLGKDTKEFKSCVK
SLFEEYPKAFNVLNILIAVRNKDEIALDADGNFYPLHSYFENDEKVYHFICQTGLEQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKAMENHLSGLFTNAQLNFKEQVDIREFEDLYQ
AFGDDIKKFDFVVCGKDKTYFIEANFYTTSGSKLNEVARSYQDLALKFEAFPNYEFIWIT
DGIGWLDAKNKLQEAYKSVEIYNLSNVNDFISKAQK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagccacctgccttttgatatttttttgcagagtcttaagataagcaatagggct
ttaggttttttcaccgattggcaaaagtgcctcaaaaatagaaatgaaataagcatcgct
ttaaaccatttgaattttttacttgggaaagatacaaaagaatttaaaagttgcgttaag
agtctctttgaagaataccccaaagcttttaatgttttaaatattctcattgctgtgagg
aataaagatgagatagcgcttgatgctgatggcaatttttatcccctacattcttatttt
gaaaatgatgaaaaggtttatcacttcatctgtcaaacggggttggagcaaattttttgt
aacagaaatattaaagatttaaatgattttgtttttggtatagaagtggggcttgatagc
aatgcaagaaaaaatcgcagcggaaaggctatggaaaatcatcttagcggtctttttacg
aacgctcaattaaattttaaagaacaagtggatattagagaatttgaggatttataccaa
gcttttggagatgatattaaaaaatttgattttgttgtttgtggtaaagataaaacctat
tttatagaagctaatttttataccactagtgggagtaagcttaatgaagtcgcaagatcc
tatcaagacttagctttaaaatttgaagcattccctaattacgaatttatttggataacc
gatggcataggttggctagacgctaaaaacaaacttcaagaagcttacaaatctgtagag
atctacaatttaagcaatgtaaatgattttatatcaaaggcgcaaaaatga

DBGET integrated database retrieval system