KEGG   Helicobacter pylori OK310: HPOK310_0474Help
Entry
HPOK310_0474      CDS       T02542                                 

Gene name
katA
Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
hpyl  Helicobacter pylori OK310
Pathway
hpyl00380  Tryptophan metabolism
hpyl00630  Glyoxylate and dicarboxylate metabolism
hpyl01100  Metabolic pathways
hpyl01110  Biosynthesis of secondary metabolites
hpyl01130  Biosynthesis of antibiotics
hpyl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HPOK310_0474 (katA)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    HPOK310_0474 (katA)
Enzymes [BR:hpyl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     HPOK310_0474 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: BAM97902
UniProt: M4ZML5
LinkDB All DBs
Structure
PDB: 

Position
491485..493002
Genome map
AA seq 505 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGAADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNPDMVWDFWSNVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKHDPD
SNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELN
KNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHGKDMHHMKKKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgacaac
aatgtgattacggctggccctagaggtcctgttttattgcaaagcacttggtttttggaa
aagttagcagcgtttgatagagaaaggatccctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcaccgtgactaaagacatcactaaatacactaaggcgaaaatt
ttctctaaagtgggcaaaaaaaccgaatgctttttcagattttctactgtggctggtgaa
agaggcgctgcggatgcggtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttagtagggaacaacacgcctgttttctttatccgtgatgcgatc
aaattccctgatttcatccacacccaaaaacgagaccctcaaaccaatttgcctaacccc
gacatggtatgggatttttggagtaatgttcctgaaagtttgtatcaagtaacatgggtt
atgagcgatagagggatccctaaatctttccgccacatggatggttttggcagccacact
ttcagtctcatcaacgctaaaggcgaacgcttttgggtgaaattccactttcacaccatg
caaggcgttaagcacttgactaacgaagaagccgcagaagtcagaaaacatgatcctgat
tccaatcaaagggatttattcaatgcgatcgctagaggggatttcccaaaatggaaatta
agcattcaagtgatgcccgaagaagatgctaaaaagtatcgattccatccgtttgatgta
accaaaatttggtatctccaagattatccgttgatggaagtgggcattgtagagttgaat
aaaaatcctgaaaactatttcgcagaagtggagcaagcggcattcagtccggctaatgtc
gttcctggaattggctatagccctgataggatgttacaagggcgcttgttctcttatgga
gacacacaccgctaccgcttaggggttaattatcctcaaataccggtcaacaaaccaaga
tgtccgttccactcttctagcagagatggctacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgcctggctacaaagaggataagagtgcgagagatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggtgattactaccgctcattgccagctgatgaa
aaagaaaggttgcatgacactattggagagtctttagctcatgttacccataaggaaatt
gtggataaacaattggagcatttcaagaaagctgatcccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatggaaaagacatgcatcac
atgaaaaagaaaaagtaa

DBGET integrated database retrieval system