KEGG   Helicobacter pylori UM066: K751_03260Help
Entry
K751_03260        CDS       T02660                                 

Definition
(GenBank) sodium:calcium antiporter
  KO
K12092  cag pathogenicity island protein 7
Organism
hpyu  Helicobacter pylori UM066
Module
hpyu_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpyu02044]
    K751_03260
Secretion system [BR:hpyu02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   K751_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagY_M CagY_I TrbI Orf78
Motif
Other DBs
NCBI-ProteinID: AGL71227
UniProt: R4QMV2
LinkDB All DBs
Structure
PDB: 

Position
984413..989806
Genome map
AA seq 1797 aa AA seqDB search
MNEENDKLETSKKTQQHSPQDLSNEETTEANHFEDSSKESKESSDHHLDNPTETKTNFDE
YESEETQTQMDSGGNETSESSNGSLADKLFKKARKLVDNKKPFTQQKNLDEEIQEPNEED
DQENNGYQEETQMDLIDDETSKKTQQHSPQDLSNEEATEANHFEDSSKESKESSDHHLDN
PTEAKTNFDEYESEEITNDSNDQEIIKGSKKKYIIGGIVVAVLIVIILFSRSIFHYFIPL
EDKSSRFSKDRNLYVNDEIQIRQEYNRLLKERNEKGNMIDKNLFFNDDPNRTLYNYLNIA
EIEDKNPLRAFYECISNGGNYEECLKLIKDKKLQDQMKKTLEAYNDCIKNAKTEEERIKC
LDLIKDENLKKSLLNQQKVQVALDCLKNAKTDEERNECLKLINDPEIREKFRKELGLQKE
LQEYKDCIKNAKTEDEKNECLKGLSKEAIERLKQQALDCLKNAKTDEERKKCLKNIPQDL
QKELLADMSVKAYKDCVSRARNEKEKKECEKLLTPEAKKKLEQQVLDCLKNAKTDEERKK
CLKDLPKDLQSDILAKESLKAYKDCVSQAKTEAEKKECEKLLTPEAKKLLEEEAKESVKA
YLDCVSQAKTEAEKKECEKLLTPEAKKKLEEAKKSVKAYLDCVSQAKTEAEKKECEKLLT
PEAKKLLEQQALDCLKSAKTDEERKKCLKDLPKDLQKKVLAKESVKAYLDCVSQAKTEAE
KKECEKLLTPEARKLLEEAKESLKAYKDCVSRARNEKEKKECEKLLTPEAKKLLEEEAKE
SVKAYLDCVSQAKTEAEKKECEKLLTPEAKKKLEEAKKSVKAYLDCVSQAKTEAEKKECE
KLLTPEAKNLLEQQALDCLKNAKTESEKKRCVKDLPKDLQKKVLAKESVKAYLDCVSRAR
NEKEKKECEKLLTPEAKKLLEEAKESLKAYKDCVSQAKTEDEKKECEKLLTPEAKKLLEE
AKESLKAYKDCVSRARNEKEKQECEKLLTPEAKNLLEQQALDCLKNAKTESEKKRCVKDL
PKDLQKKVLAKESVKAYLDCVSRARNEKEKKECEKLLTPEAKKLLEEAKESLKAYKDCLS
QARNEEERRACEKLLTPEAKKLLEQEVKKSVKAYLDCVSRARNEKEKQECEKLLTPEARK
FLAKQVLSCLEKARNEEERKACLKNIPKDLQKNVLAKESLKAYKDCLSQARNEEERRACE
KLLTPEAKKLLEQEVKKSVKAYLDCVSRARNEKEKQECEKLLTPEARKFLAKELQQKDKA
IKDCLKNADPNDRAAIMKCLDGLSDEEKLKYLQEAREKAVLDCLKTARTDEEKRKCQNLY
SDLIQEIQNKRTQSKQNQLSKTERLHQASECLDNLDDPTDQEAIEQCLEGLSDSERALIL
GIKRQADEVDLIYSDLRNRKTFDNMAAKGYPLLPMDFKNGGDIATINATNVDADKIASDN
PIYASIEPDITKQYETEKTIKDKNLEAKLAKALGGNKKDDDKEKSKKSTTEAKTESNKID
KDVAETAKNISEIALKNKKEKSGEFVDENGNPIDDKKKTETQDETSPVKQAFIGKSDPTF
VLAQYTPIEITLTSKVDATLTGIVSGVVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTP
IMTRLMIVFTKAITPDGVIIPLANAQAAGMLGEAGVDGYVNNHFMKRIGFAVIASVVNSF
LQTAPIIALDKLIGLGKGRSERTPEFNYALGQAINGSMQSSAQMSNQILGQLMNIPPSFY
KNEGDSIKILTMDDIDFSGVYDVKITNKSVVDEIIKQSTKTLSREHEEITTSPKGGN
NT seq 5394 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaaacgataaacttgaaacttctaaaaaaacccaacaacattcaccccaa
gatttatccaatgaagaaacaacagaagccaatcactttgaagattcttcaaaagaatcc
aaagaaagctcagatcatcatcttgacaaccccacagaaactaaaaccaattttgatgaa
tacgagtcagaagaaacccaaactcaaatggattctggaggtaatgaaacttcagaatct
agcaatggcagtctagcagacaagttattcaaaaaagctagaaaattagttgataataaa
aaacctttcactcagcaaaagaatttagatgaagaaatccaagaaccgaacgaagaagac
gatcaagaaaataatgggtatcaagaagaaactcaaatggacttaattgatgatgaaact
tctaaaaaaacccaacaacattcaccccaagatttatccaatgaagaagcaacagaagcc
aatcactttgaagattcttcaaaagaatccaaagaaagctcagatcatcatcttgacaac
cccacagaagctaaaaccaattttgatgaatacgagtcagaagaaataactaacgattct
aacgatcaagagattatcaaaggaagcaaaaagaaatacattattggtggcattgtagtc
gctgttcttatcgtgattattttattttctagaagcatttttcactacttcatacctttg
gaagataaaagctctcgttttagcaaagacaggaatctttatgtcaatgatgaaatccaa
ataaggcaagagtataaccgattgctgaaagaacggaatgaaaaaggcaatatgatcgat
aagaatctttttttcaatgacgatcccaatagaaccttatacaactatttgaatattgca
gaaattgaggacaaaaacccattgagagccttttatgaatgtattagtaatggtggcaac
tatgaagaatgtttgaagcttatcaaagataaaaaacttcaagatcaaatgaaaaagact
ttagaggcttataatgactgcatcaaaaatgccaaaactgaagaagaaaggatcaagtgt
ttagatttaatcaaagatgaaaacctgaaaaaaagcttactgaaccaacaaaaagttcaa
gtagcactagattgtttgaaaaacgctaaaaccgatgaagaacgaaacgagtgcctaaaa
ctcataaatgaccctgagattagagagaaattccgtaaggaattagggcttcaaaaagag
cttcaagagtataaggattgtatcaaaaacgccaaaacagaagatgagaaaaacgaatgc
ttgaaaggcttgtctaaagaagctatagaaagattgaaacagcaagcgctagattgtttg
aaaaacgctaaaaccgatgaagaacgaaaaaagtgtttgaaaaatattccccaagacttg
caaaaagaactactagctgatatgagcgtcaaggcttacaaggattgcgtttcaagagct
aggaatgaaaaagagaaaaaagaatgcgagaaattactcacgcctgaagcgaaaaaaaag
ttagaacaacaggttctagattgtttgaaaaacgctaaaactgatgaagaacgaaaaaag
tgtttgaaagatctccctaaagacttacaaagcgatattttagctaaagagagtcttaaa
gcttataaagactgcgtatctcaagccaaaactgaagctgagaaaaaagaatgcgagaaa
ttgctcacccctgaagcgaaaaagctcttagaagaagaagccaaagagagcgttaaggct
tacttggattgcgtatctcaagctaaaactgaagctgagaaaaaagaatgcgagaaatta
ctcacgcctgaagcgaaaaaaaagttagaagaagctaaaaaaagcgttaaagcttacttg
gattgcgtgtctcaagccaaaactgaagctgagaaaaaagaatgcgagaaattgctcacg
cctgaagcgaaaaaacttttagaacaacaagcgctagattgtttgaaaagtgctaaaact
gatgaagaacgaaaaaagtgtttgaaagatctccctaaagacttgcagaaaaaggtttta
gctaaagagagcgttaaggcttatttggactgcgtatctcaagccaaaactgaagctgag
aaaaaagaatgcgagaaattgctcacccctgaagcgagaaagcttttagaagaagctaaa
gagagcctgaaagcttataaagactgcgtttcaagagctaggaatgaaaaagagaaaaaa
gaatgcgagaagttactcacccctgaagcgaaaaagcttttagaagaagaagccaaagag
agcgttaaggcttacttggattgcgtatctcaagccaaaactgaagctgagaaaaaagaa
tgcgagaaattgctcacccctgaagcgaaaaaaaagttagaagaagctaaaaaaagcgtt
aaggcttatttggattgcgtatctcaagccaaaactgaagctgagaaaaaagaatgcgag
aaattactcacccctgaagcgaaaaatcttttagagcaacaagcgctagattgtttgaaa
aacgctaaaaccgaatctgagaaaaaaaggtgtgtcaaagatctccctaaagacttgcag
aaaaaggttttagccaaagagagcgttaaggcttatttggactgcgtttcaagagctagg
aatgaaaaagagaaaaaagaatgcgagaagttactcacgcctgaagcgaaaaagctttta
gaagaagctaaagagagtcttaaagcttataaagactgcgtatctcaagccaaaactgaa
gatgagaaaaaagaatgcgagaagttactcacgcctgaagcgaaaaagcttttagaagaa
gctaaagagagcctaaaagcttataaagactgcgtttcaagagctaggaatgaaaaagag
aaacaagaatgcgagaaattgctcacgcctgaagcgaaaaatcttttagagcaacaagcg
ctagattgtttgaaaaacgctaaaaccgaatctgagaaaaaaaggtgtgtcaaagatctc
cctaaagacttgcagaaaaaggttttagccaaagagagcgttaaggcttatttggactgc
gtttcaagagctaggaatgaaaaagagaaaaaagaatgcgagaaattactcacgcctgaa
gcgaaaaaacttttagaagaagctaaagagagtcttaaagcttataaagactgcctctct
caagctagaaatgaagaagaaaggagagcttgcgagaaattactcacccctgaagcaaaa
aaacttttagagcaagaagttaagaagagtgttaaggcttatttggactgcgtttcaaga
gctaggaatgaaaaagagaaacaagaatgcgagaaattgctcacccctgaagcgagaaaa
tttttagcgaagcaagtgctaagttgtttggaaaaagctagaaatgaggaagaaagaaaa
gcatgtcttaaaaatatccctaaagacttacagaaaaatgttttagctaaagagagtctt
aaagcttataaagactgcctctctcaagctagaaatgaagaagaaaggagagcttgcgag
aaattactcacccctgaagcaaaaaaacttttagagcaagaagttaagaagagtgttaag
gcttatttggactgcgtttcaagagctaggaatgaaaaagagaaacaagaatgcgagaaa
ttactcacccctgaagcgagaaaatttttagcgaaagaactccagcaaaaagataaagcg
atcaaagattgcttgaaaaacgccgatcctaacgacagagcggctattatgaagtgtttg
gatggtttgagcgatgaagagaagctcaaatacctgcaagaagctagagaaaaggctgtc
ttggattgtttgaaaacggctaggaccgatgaagaaaaaaggaaatgtcaaaacctttat
agcgatttgatccaagaaatccaaaataaaaggacacaaagcaaacaaaatcaattgagt
aaaacagaaagattgcatcaagcaagcgagtgcttggataacttagatgaccctactgat
caagaagccatagagcaatgtttagagggcttgagcgatagtgaaagggcactaattcta
ggaattaaacgacaagctgatgaagtggatctgatttatagcgatctaagaaaccgcaaa
acctttgataacatggcagctaaaggttatccattgttgccaatggatttcaaaaatggc
ggcgatattgccactattaacgccactaatgttgatgcggacaaaatagctagcgataat
cctatttatgcttccatagagcctgacattaccaagcaatacgaaacagaaaaaaccatt
aaggataagaatttagaagctaaattagctaaggctttaggtggtaataaaaaagatgac
gataaagaaaaaagtaaaaaatccaccacagaagctaaaacagaaagcaataagatagac
aaagatgtcgcagaaactgccaagaatatcagtgaaatcgctcttaagaacaaaaaagaa
aagagtggggaatttgtagatgaaaatggtaatcccattgatgacaaaaagaaaacagaa
acacaagatgaaacaagccctgtcaaacaggcctttataggcaagagtgatcccacattt
gttttagcgcaatacacccctattgaaatcactctgacttctaaagtagatgccactctc
acaggtatagtgagtggggttgtagccaaagatgtatggaacatgaacggcactatgatc
ttactagacaaaggcactaaggtgtatgggaattaccaaagcgtgaaaggtggcacaccc
attatgacacgcttaatgatagtctttactaaagccattacgcctgatggtgtgataata
cctctagcaaacgctcaagcagcaggcatgctgggtgaagcaggggtagatggctatgtg
aataatcactttatgaaacgcataggctttgctgtgatagcaagcgtggttaatagcttc
ttgcaaactgcacctatcatagctctagataaactcataggccttggcaaaggtagaagt
gaaaggacacctgaatttaattacgctttgggtcaagctatcaatggtagtatgcaaagt
tcagctcagatgtctaatcaaattctagggcaactgatgaatatccccccaagtttttac
aaaaatgagggcgatagtattaagattctcacaatggacgatattgattttagtggcgtg
tatgatgttaaaattaccaacaaatctgtggtagatgaaattatcaaacaaagcactaaa
actttgtctagagagcatgaagaaatcaccacaagccccaaaggtggcaattaa

DBGET integrated database retrieval system