KEGG   Helicobacter pylori UM066: K751_04335Help
Entry
K751_04335        CDS       T02660                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpyu  Helicobacter pylori UM066
Pathway
hpyu00473  D-Alanine metabolism
hpyu00550  Peptidoglycan biosynthesis
hpyu01100  Metabolic pathways
hpyu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    K751_04335
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    K751_04335
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    K751_04335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpyu01011]
    K751_04335
Enzymes [BR:hpyu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     K751_04335
Peptidoglycan biosynthesis and degradation proteins [BR:hpyu01011]
 Precursor biosynthesis
  Amino acid ligase
   K751_04335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_TupA RimK ATP-grasp_3 VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: AGL71434
UniProt: R4QDL9
LinkDB All DBs
Structure
PDB: 

Position
complement(757678..758721)
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIALKEALKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLPPLILTRNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKTLDYVLLNEKNRANALNLIGFNFPFIVKPSNAGSSLG
VSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKNFCFSYIEEPNKQEF
LDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGALIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKTTLENLAQSLPKTPKIPIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggaattttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagt
gcgatcgcacttaaagaagcactaaaggataggattaaatactttatttttttagatgaa
aaccatcatttttacttgattgaagaatctaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattaccccccctaatccttacgcgcaatggtttgcttaagaactcgttt
ttaggcgctaagattatagaattacccttagtgattaatcttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgcatcgcttttataggccctagg
attgaagcaagcgtgttgagttataacaaatatttaaccaagctttatgccaaagactta
ggggtaaagactttagattatgttcttttgaatgaaaaaaaccgtgctaacgctctaaat
ttgattggctttaattttccttttattgtcaagcccagcaacgccggaagctctttaggg
gtgagcgttgtgaaagaagaaaaagaattgatttacgctttagacggtgcgtttgaatat
tctaaagaggtcttaatagagcctttcattcagggagtgaaagaatacaatttagccggc
tgtaagatcaaaaagaatttttgtttttcctatattgaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaacaaagcccctaaagcgaatctt
tctaacgccctagaagaacaattgaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgctcatccgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggccaattatttgtttgatgattttaaaacaacgcta
gaaaatttagcacaatcattacccaaaacccctaaaatcccaatcaaaaattcttatttg
ttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system