KEGG   Helicobacter pylori UM066: K751_07180Help
Entry
K751_07180        CDS       T02660                                 

Definition
(GenBank) restriction endonuclease MboI
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
hpyu  Helicobacter pylori UM066
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:hpyu02048]
    K751_07180
Enzymes [BR:hpyu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     K751_07180
Prokaryotic defense system [BR:hpyu02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    K751_07180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C Chordopox_A15 DUF3227
Motif
Other DBs
NCBI-ProteinID: AGL71982
UniProt: R4QPS1
LinkDB All DBs
Position
complement(119563..120396)
Genome map
AA seq 277 aa AA seqDB search
MKNHLPFDIFLQSLKTSNRNLGFFTDWQKCLKNRNEISIALNHLNFLLGKDTKEFKSCVK
SLFKEYPKAFNVLNILIAVRNKDEVALDADGNFYPLHSYFENDEKVYEFIRQTGLEQIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKAMENHLSGLFFQAQLNFKEQVDIREFEDLYQ
AFGDDIKKFDFVVCGKDTTYFIEANFYTISGSKLNEVARSYQELALKFEAFPNYEFIWIT
DGIGWLDAKSKLQEAYKSVEIYNLSNVNDFISKVQKW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccatctgccttttgatatttttttgcagagtcttaagacaagcaataggaat
ttaggctttttcaccgattggcaaaagtgcctcaaaaatagaaatgaaataagcatcgct
ttaaatcatttgaattttttacttgggaaagatacaaaagaatttaaaagttgcgttaag
agtctttttaaagaataccccaaagcttttaatgttttaaatattctcattgctgtgagg
aataaagatgaggtagcgcttgatgctgatggcaatttttaccccctacattcttatttt
gaaaatgatgaaaaagtctatgaatttattcgtcaaacggggttggagcagattttttgt
aacagaaatattaaagatttaaatgattttgtttttggtatagaagtagggcttgatagc
aatgcaagaaaaaatcgtagcggaaaggctatggaaaatcatcttagcggtctttttttt
caagctcaattaaattttaaagaacaagtagatattagagaatttgaggatttataccaa
gcttttggagatgatattaaaaaatttgattttgttgtttgtggtaaagatacaacttat
tttatagaagctaatttttataccattagtgggagtaagcttaatgaagtcgcaagatct
tatcaagaattagctttaaaatttgaagcattccccaattacgaatttatttggataacc
gatggcataggttggctggacgctaaaagcaaacttcaagaagcttacaaatctgtagag
atctacaatttgagcaatgtgaatgattttatatcaaaggtgcaaaaatggtaa

DBGET integrated database retrieval system