KEGG   Helicobacter pylori 52: HPKB_0694Help
Entry
HPKB_0694         CDS       T01898                                 

Definition
(GenBank) hypothetical protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hpz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    HPKB_0694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hpz03400]
    HPKB_0694
Enzymes [BR:hpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     HPKB_0694
DNA repair and recombination proteins [BR:hpz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     HPKB_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ACX99288
UniProt: D0JZL8
LinkDB All DBs
Position
complement(720572..721201)
Genome map
AA seq 209 aa AA seqDB search
MQLSRLQTLRSLYMERLLGETYTNINLTKPQNKPLNKQVYEGIENCNLCKRHQNSKPVIG
LFNPTSKLTFITLTPMLDSQLNFLNNLKAAMLESIIQKVFNCPLKDCSILSLLKCDSNSL
NLEEEINACLFHLTWQLDNSASKVIVVFGEILPKRLLNLSKEESFGRIVSLKTKHFLSTH
ALEDMLKNPTLKKEALAHFKIALQFLNQS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgcaactttcacgccttcaaactttacgctctctctatatggagcgtcttttgggcgaa
acttacaccaatatcaaccttaccaagccccaaaataagccccttaacaaacaagtttat
gagggcatagaaaattgcaatctgtgcaaacgccatcaaaattcaaaaccggtgatcgga
ctttttaaccccacttccaagctcactttcatcacgctaacccccatgctggatagccaa
ttgaatttcttaaacaatttaaaagcggccatgttagagagcattatccaaaaagttttt
aactgccccttaaaagattgcagtattttatcgctccttaaatgcgactctaacagcctt
aatttagaagaagaaatcaacgcatgcctatttcatttaacctggcaattagacaacagc
gcttcaaaagtcattgtggtatttggcgagattttgcccaaacgccttttaaacctttct
aaagaagaatcctttgggcgcatcgtgtctttaaaaacaaaacattttttaagcacccat
gctttagaggacatgctcaaaaaccccacgctcaaaaaagaagcgttagcgcattttaaa
atagcgctccaatttcttaaccaatcttaa

DBGET integrated database retrieval system