KEGG   Herbaspirillum rubrisubalbicans: Hrubri_0313Help
Entry
Hrubri_0313       CDS       T04238                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00473  D-Alanine metabolism
hrb00550  Peptidoglycan biosynthesis
hrb01100  Metabolic pathways
hrb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hrubri_0313 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hrubri_0313 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Hrubri_0313 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hrb01011]
    Hrubri_0313 (ddlB)
Enzymes [BR:hrb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Hrubri_0313 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:hrb01011]
 Precursor biosynthesis
  Amino acid ligase
   Hrubri_0313 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp TTL CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ALU87542
UniProt: A0A0U3K4B5
LinkDB All DBs
Position
360387..361391
Genome map
AA seq 334 aa AA seqDB search
MISQDQIKAFGRVGVLFGGRSAEREVSLMSGNGVLQALRSKGVDAHPFDPAERSLGELQA
EQFDRVFIALHGRYGEDGTLQGALEQMGLPYTGPGVMASSIAMDKIMTKRIWLSHGLVTP
RFLSLDAKSTTREQLRVVPDELGLPLMLKAPHEGSTIGIAKVNGYSDMQVSFDLCARYDS
VVLAEEFIRGRELTVPVLGKGRDARALPIIEICAPGGNYDYQNKYFTDDTKYYCPAPLDE
ELTRHIQDLAVRAFNALGCRGWSRVDFMLREGDGKAEPYLIEINTSPGMTGHSLVPMAAK
AVGMSYEDLCCEILQMAALDMRPSKDWTPQVAQS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatcagccaggaccagatcaaggcctttggccgtgtcggtgtgctcttcggtggtcgt
tccgccgagcgcgaagtatcgctgatgtcgggcaatggcgtgctgcaggccttgcgcagc
aagggcgtcgatgcccatccctttgacccggctgaacgcagcctgggtgagttgcaggcc
gagcagttcgaccgcgtcttcattgccctgcacggtcgctatggcgaggacggcacgctg
caaggcgcgctggaacagatgggattgccctacaccggcccgggcgtgatggcctcgagc
atcgccatggacaagatcatgaccaagcgcatctggctctcgcacggcctggtcacgccg
cgcttcctgagcctggatgccaagagcaccacacgtgaacaattgcgcgtggtccccgat
gagctgggcctgccgctgatgttgaaggcaccgcacgagggttcgaccatcggcattgcc
aaggtgaatggttattccgacatgcaggtcagcttcgacctgtgcgcccgctatgacagc
gtggtgctggccgaggaattcatccgtggccgcgaattgacggtgccggtgctgggcaaa
ggacgcgatgcgcgggccttgccgatcatcgagatctgcgcgccgggtggcaattacgac
taccagaacaagtatttcaccgacgacacgaaatattactgccccgccccgctggacgag
gaactgacgcgccacatccaggatctggcggtacgggccttcaatgcgctgggttgccgc
ggctggagccgggtggacttcatgctgcgcgagggggatggcaaggccgagccttacctg
atcgaaatcaatacctcgcccggcatgaccggccattcgctggtgccgatggcggccaag
gcggtgggcatgagttatgaagatctgtgctgtgaaattctgcagatggccgcgctggac
atgaggccatccaaggactggacgccgcaggtggcacagtcgtga

DBGET integrated database retrieval system