KEGG   Herbaspirillum rubrisubalbicans: Hrubri_0882Help
Entry
Hrubri_0882       CDS       T04238                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00250  Alanine, aspartate and glutamate metabolism
hrb00410  beta-Alanine metabolism
hrb00640  Propanoate metabolism
hrb00650  Butanoate metabolism
hrb01100  Metabolic pathways
hrb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Hrubri_0882 (puuE)
   00650 Butanoate metabolism
    Hrubri_0882 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hrubri_0882 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hrubri_0882 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hrb01007]
    Hrubri_0882 (puuE)
Enzymes [BR:hrb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Hrubri_0882 (puuE)
Amino acid related enzymes [BR:hrb01007]
 Aminotransferase (transaminase)
  Class III
   Hrubri_0882 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALU88099
UniProt: A0A0U3LEW1
LinkDB All DBs
Position
complement(1008417..1009697)
Genome map
AA seq 426 aa AA seqDB search
MTSKANNQELQQRKNAATPRGVGVMCDFYAERAANAELWDVEGRRFIDFAAGIAVLNTGH
RHPKLLDAMRAQMEKFTHTAYQIVPYASYVELAERINAVTPGHYPKKTAFFSTGAEAVEN
AIKIARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLGFGPFPGDVFHAPYPSALNG
ISTEDALEAVKGLFKSDIEAKRVAAIILEPVQGEGGFYAAPADFMRGLRAICDEHGILLI
ADEVQSGYGRTGKLFAMEHYDVLPDLMTMAKSLAGGMPLSAVNGRAEIMDAPAPGGLGGT
YAGNPLAVASALAVLDVMEEEKLVARGQRLGDKLQEHLKELRSAVPQIAEVRGVGAMVAV
EFADPATGKPDAEYTKKVQQHALSNGLLLLSCGSYGNVIRFLFPLTIPDAVMDEALGILA
NAIKLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaaggccaacaaccaagagctgcaacaacgaaagaatgccgcgaccccgcgc
ggcgtgggtgtgatgtgcgacttctacgccgagcgcgccgctaatgccgagttgtgggac
gtcgagggccgccgcttcatcgacttcgccgcgggcatcgccgtgctcaatactggccat
cgccaccccaagctgctcgacgccatgcgcgcgcagatggaaaaattcacccacaccgcc
taccagatcgtgccctacgccagctatgtggaactggccgagcgcatcaacgcggtgacc
ccgggtcactatccgaagaagaccgccttcttctccaccggcgccgaagccgtggaaaac
gccatcaagatcgcccgcgcctacactggccgtccgggcgtgatcgcctttgccggtggc
ttccatggccgcaccatgatgggcatggcactgaccggcaaggtcgcgccctacaagctg
ggcttcggtccattccccggcgacgtgttccatgcgccctacccgagcgccttgaacggc
atcagcaccgaggatgcgctggaagcggtcaagggtctcttcaagagcgacatcgaagcc
aagcgcgtggccgccatcatcctggaaccggtgcagggcgaaggcggtttctacgcagcg
ccagccgacttcatgcgcggcctgcgcgccatctgcgatgagcacggcatcctgttgatc
gccgatgaagtgcagtccggctatggccgtaccggcaagctgtttgccatggaacactac
gacgtgctgcccgacctgatgaccatggccaagagcctggccggcgggatgccgctgtcg
gccgtcaacggtcgtgccgagatcatggatgcaccagccccgggtggcctgggtggcacc
tatgccggcaacccgctggcagtggcgtcggccctggccgtgctggacgtaatggaagaa
gaaaagctggtggcccgtggtcagcgcctgggcgacaagctgcaggaacacctcaaggaa
ttgcgttcggccgtgccgcagatcgctgaagtgcgcggcgtgggtgccatggtggcggtg
gagttcgccgatccggccaccggcaagccggatgcggaatacaccaagaaggtccagcaa
cacgccctcagcaatggcttgctgctgctgtcctgtggcagctacggcaacgtgatccgc
ttcttgttcccgctgaccattcccgatgccgtcatggatgaagcgctgggcattttggcc
aacgccatcaagctggcctga

DBGET integrated database retrieval system