KEGG   Herbaspirillum rubrisubalbicans: Hrubri_1723Help
Entry
Hrubri_1723       CDS       T04238                                 

Definition
(GenBank) ABC-type transport system, duplicated ATPase component protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hrubri_1723
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hrb02000]
    Hrubri_1723
Transporters [BR:hrb02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Hrubri_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_16 AAA_22 TniB ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: ALU88928
UniProt: A0A0U2SEA7
LinkDB All DBs
Position
complement(2002389..2003348)
Genome map
AA seq 319 aa AA seqDB search
MLTIENLKIEFMSHGRRVAPVDGVSFSLGQDETVGLLGESGCGKSVTALSILRLFPMASQ
ARLSGSIRFGERELLQADDATLRRIRGKEIAMIFQEPMTSLNPLHRIGEQLSEMLRIHTA
LPRQEIDAKVIAMLERVGLSRAAQLVDEYPHSLSGGMRQRVMIAMALLCQPRLLVCDEPT
TALDVTIQAQILDLMRDLKREQQTSILMITHDLGVVAEMCQRVVVMYAGQVVEQSSVEDL
FDRPAHPYTHALMRARPALDATPGVPLTAIPGSVPPPGTITQGCRFAARCARAQDICRQE
MPTLENLGDGHSVRCWYPH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccatcgagaatctcaagatcgaattcatgagccacggtcgccgggttgcgccg
gtcgatggcgtttccttctccctgggccaggatgaaacggtcggcctcttgggtgaatcc
ggctgcggcaagagcgtgacagccctgtccatcctgcgcctgttccccatggccagccag
gcccggctgtcgggcagcatccgctttggcgaacgtgagctgctgcaagccgacgacgcc
accctgcgccgcatccgcggcaaggagatcgccatgatcttccaggagccgatgacgtcg
ctaaacccgctgcaccgcatcggcgagcaattgagcgagatgctacgcatccacactgcc
ctgccgcgccaggagattgatgccaaagtcattgccatgctggagcgcgtgggcctgtcg
cgtgcggcgcagctagtggacgaatatccgcacagcctttccggcggtatgcgccagcgc
gtcatgattgccatggctctgctgtgccagcctcgcctgctggtctgcgacgagcccacc
acggcgctggacgtgaccatccaggcgcagatcctcgacctgatgcgcgacctgaagcgc
gagcagcagacttccatcctcatgattacccacgacctgggcgtggtggccgagatgtgc
cagcgcgtggtggtgatgtatgcgggccaggtggtggagcaaagcagcgtggaggatctc
ttcgaccgccccgcccatccctacacgcacgccctcatgcgcgcacggccggcgctggac
gccacgcccggcgtgcccctgacggccatccccggcagcgtgccgccgcccggcaccatt
acccaaggctgccgcttcgccgcccgctgcgcccgcgcccaggacatctgccgccaggag
atgcccacgctggaaaacctgggcgatggccacagcgtgcgctgctggtatccgcattga

DBGET integrated database retrieval system