KEGG   Herbaspirillum rubrisubalbicans: Hrubri_1752
Entry
Hrubri_1752       CDS       T04238                                 

Gene name
alkA
Definition
(GenBank) 3-methyl-adenine DNA glycosylase II protein
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Hrubri_1752 (alkA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hrb03400]
    Hrubri_1752 (alkA)
Enzymes [BR:hrb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     Hrubri_1752 (alkA)
DNA repair and recombination proteins [BR:hrb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Hrubri_1752 (alkA)
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-ProteinID: ALU88956
UniProt: A0A0U3KXW6
LinkDB
Position
2037145..2037804
AA seq 219 aa
MNTNRKASDADPSLIVPAYWEDAKAELMKRDRIMRKIIPQFGDLQLTVRGDAFTTLARSV
IGQQISTKAANAVWQRFLQACPRCTPGQVIRTGPEGLAACGLSKRKAEYILDLAAHFKAK
TVHPDKWAEMEDEAVIAEMIQIRGIGRWTAEMFLIFNLLRPNVLPLDDLGLLKGISISYF
SGEPVSRSDAREVAANWEPWRTVATWYLWRSLDPLPSDY
NT seq 660 nt   +upstreamnt  +downstreamnt
ttgaataccaaccgaaaagccagtgacgccgatcccagcctgatcgtgccggcctactgg
gaagacgccaaggccgagctgatgaagcgcgaccgcatcatgcgcaagatcatcccgcag
ttcggggacttgcaattgacggtgcgtggcgatgccttcaccacgctggcgcgttcggtg
atcggccagcagatctcgaccaaggccgccaatgcggtttggcagcgcttcctgcaagcc
tgtccgcgctgcaccccgggccaggtgatccgtaccggcccagaagggctggccgcttgc
ggtttgtccaagcgcaaggccgaatatatcctcgacctggccgcccacttcaaggccaag
acggtacatcccgacaaatgggcggagatggaagacgaagccgtcattgccgagatgatc
cagatccgtgggattggccgctggacagccgagatgtttttgatatttaatctgctgcgc
cccaacgtactgccgctggatgacctgggattgctcaagggcatcagcatcagttacttc
tcgggggagcccgtctcgcgcagcgatgcgcgcgaagtcgccgcgaactgggaaccgtgg
cgcaccgtggccacctggtacctgtggcgcagcctggatccgctgccctccgattattga

DBGET integrated database retrieval system