KEGG   Herbaspirillum rubrisubalbicans: Hrubri_1778Help
Entry
Hrubri_1778       CDS       T04238                                 

Gene name
exaC
Definition
(GenBank) NAD+ dependent acetaldehyde dehydrogenase protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00010  Glycolysis / Gluconeogenesis
hrb00620  Pyruvate metabolism
hrb01100  Metabolic pathways
hrb01110  Biosynthesis of secondary metabolites
hrb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hrubri_1778 (exaC)
   00620 Pyruvate metabolism
    Hrubri_1778 (exaC)
Enzymes [BR:hrb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Hrubri_1778 (exaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ALU88982
UniProt: A0A0U3K8H0
LinkDB All DBs
Position
2067280..2068800
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLGVRDPFKQRYDNFIGGKFVPPVKGEYFENISPVIGRAFCEVARSSAEDVEL
ALDAAHAAKKAWGKTSPTERANLLLKIADRMEANLELLATAETLDNGKPIRETMAADIPL
AIDHFRYFAAAVRTQEGSICPIDDDTYAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVLVELIADLLPPGVLNIVQGFGVEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLDKDDAFFDKALEGFAMFALNQGEV
CTCPSRVLVQESIYERFIERALKRVAAIKQGNPLDKSTMIGAQASQEQLEKILSYIDIGK
QEGAKVLAGGGREELGGDLASGYYVKPTVFQGNNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGLWTRDGTRAFRMGREIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggcagacatcagcaaactcggtgtacgtgaccctttcaagcaacgttacgac
aacttcatcggtggtaaattcgtgccgccggtcaagggggaatacttcgagaacatcagc
ccggtgatcggacgcgccttctgtgaagtggcccgttccagcgccgaagacgtggaactg
gcgctggacgccgcccatgccgccaagaaggcctggggcaagacctcgccgaccgaacgc
gccaacctgctgttgaagatcgccgaccgcatggaggccaatctggaactgctggccacc
gccgaaaccctggataacggcaagcccatccgcgaaaccatggccgccgacattccgctg
gccatcgaccacttccgctatttcgccgccgccgtgcgtacccaggaaggcagcatctgc
cccatcgacgacgacacctatgcctaccacttccatgaaccgctgggcgtggtcggccag
atcatcccctggaacttcccgatcctgatggcggtgtggaagctggccccggccctggcc
gcgggcaactgcgtggtcttgaagccggccgagcagactccggcctccatcatggtgctg
gtcgaactgatcgccgacctgcttccgcccggcgtgctcaacatcgtgcagggctttggc
gtggaagccggcaagccgctggcttccaacaagcgtatcgccaagatcgccttcaccggc
gagaccaccactggtcgcctgatcatgcaatatgcctcgcagaacctgatcccggtaacc
ctggaactgggcggcaagtcgcccaacatcttctttgccgatgtgctggacaaggacgat
gccttcttcgacaaggccctggaaggtttcgccatgttcgcgttgaaccagggcgaggtc
tgcacctgcccctcgcgcgtgctggtgcaggaatcgatctacgagcgcttcatcgagcgc
gccctgaaacgcgtggccgccatcaagcagggcaacccgctggacaagagcaccatgatc
ggcgcgcaagcctcgcaggagcagctggaaaagatcctgtcctacatcgacatcggcaag
caggaaggcgccaaggtgctggccggcggtggacgcgaagaactgggcggtgacctggcc
tcgggctattacgtcaagccgaccgtgttccagggcaataacaagatgcgcatcttccag
gaagaaatctttggcccggtggtctcggtgaccaccttcaaggatgaggaagaagcgctg
gccatcgccaacgacaccctgtacggcctgggtgcgggcctgtggacccgcgatggcacc
cgtgccttccgcatgggtcgcgagatccaggccggtcgggtgtggaccaactgctatcac
ctgtatccggcgcacgctgccttcggtggctacaagcaatccggcatcggtcgcgaaaac
cacaagatgatgctggaccactaccagcagaccaagaacctgctggtcagctacagcccc
aaggcgctgggcttcttctga

DBGET integrated database retrieval system