KEGG   Herbaspirillum rubrisubalbicans: Hrubri_2252Help
Entry
Hrubri_2252       CDS       T04238                                 

Definition
(GenBank) non-ribosomal peptide synthetase protein
Organism
hrb  Herbaspirillum rubrisubalbicans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C AMP-binding_C_2 Transferase
Motif
Other DBs
NCBI-ProteinID: ALU89442
UniProt: A0A0U3LFD9
LinkDB All DBs
Position
2619502..2624871
Genome map
AA seq 1789 aa AA seqDB search
MRSAESSTALPFKGARNFVERLEQLARERPDDTALIVVQAVAGVDQERRFSYQVLAQRVR
ALAAVLQARLGRGERALILLDNDEYYAISMFACFYAGVIAVPVFPPESASAAHTGRLAGI
AADAGARGLLILDANRALVAACEGLQQAEMIAVDQIGAGDRGPWQAAAPDPQEIAFLQYT
SGSTSAPKGVMVTHAALMANEAAIREGLSIGEGDSFCVWSPLFHDMGLIGGLLQPFYSGI
VCVLCSPRYFLERPVRWLQMIARHRVSISGGPDFAYRLCLDRIKDRQLEGLDLSCWRVAY
TGAEPVRHQTMEAFVQRFASVGLDPAAVYPCYGLAEATLFVTGGRRGAGLRVQRYLPHAL
RSRLALPADAEEPAVALVACGRAPSQHQVRIAADASGAPAAPGGIGEIWVTGPSIARGYW
KQALQSAQTFVELENQTWLRTGDLGFWADGELFVAGRLKDMIIVRGHNIYPQDLEQALEA
EVEALRKGRIAVFAVSLDTEEGVGVAVEVSRGMQKLVAPQALCEAVATVVQRQCGEAPQV
LVLLNPGGLPKTSSGKLQRGACRTGWHQGSLDAYAVFEQGRMVQGSQSTTMATVPPVAAQ
RAGEPEVRAALALLWQEVLMPGVAGEPSADAHFLACGGNSLAAVQLAARISQHWQIAFAA
SQVFEYPRLQQQAALILDALEDGKGGTATGIARLSEAQRRTPQPLSSAQQRQWFLWQLAP
QSTAYHVQGALRLGGPLDVFALQRAFNALMRRHEVLQTVFRSTDQGQLEQVVGTQPVAEL
ELVEADTGPNGALSLPAALDLLQQRHGQPFDLTHGPLVRACLLALDDGSHVLGMVMHHII
SDGASMHLLIEELAQLYAELHAGRQSALAPAILHYVDYIAWQQARADDPEHRVALDYWTR
ELAVPAGQAQPVLALPVDRARPVLARYHASHHHFALPDDLLAGLRGQARQAGMTLFALLL
SGLQALLHRYTGQQDIRVGVPVANRSHPDLLGVVGFFVNTLVLRAPFDEDITLAQLLAQT
AQRTLLAQRHQGLPFEQLVEVLQPERSLTHSALFQVMFNHLPQHYAASAQGLGDVVEELF
LPDREAQFELTLDTREHPDGRVSAVLTYAKELFDPQRIAQLAQSYLAILRALVDEPQQLV
AEVALLSPAQQAQLQQWGCNPQRYPLDPPIHVRIAQQARRTPEAIALVLDRQQLSYAQLE
ARANQMARQLLAMGVQPEQRIGLALERSLDMVPALLAILKAGACFVPLDPQYPRARLTAM
IEDSRIRLALTQSHMREHLPGQAGVRWLELDRLPAPAATSDFMEAPDVITHPAQLAYVIY
TSGSTGRPKGVAVSHGALVEHTQLSAEFSRLRNDDRMLQFATLNFDGFIEQLFPPLLVGA
SVVLRGPQLWSPEEFQQRLREHDISIADLPTAYWHALIQSFARQGQSDYGRLREIHIGGE
AMPAESIATWRQAGLSAVRLLNTYGPTEAVVVASLLDCDPFVQGQREVPTQMPIGQPLAG
RSLHVLDERLQALPAGVPGELYIGGDLLARGYLERPGLTAERFVADPGSEAGGRLYRTGD
LVCWNAQSELHYLGRSDLQVKLRGFRVELGEIEAQLLAQPEVRQAIVVAHQARLVGYASL
YPGQELSTAQLRERLRASLPDYMVPATVIVLEQLPTNPNGKIDRHALPAPADVIAVGGLA
PVGQLEEQLGGIWRELLRLEQVGRDDNFFELGGHSLLLLVAHERIKALSLACVPSVVDLF
RYPTIATLAAFLDGAAPTRNDAGPALEERAARQRGGFLSRRRQPSGAEQ
NT seq 5370 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggcggagtcctccacggcattgcccttcaagggcgcccgcaacttcgttgaa
cggctggagcagctagcccgggaacggcccgacgataccgcgctcatcgtggtgcaggcg
gtggcgggcgtcgaccaggagcgccggttcagttaccaggtattggcgcaacgcgtgcgc
gcactggcggcggtgctgcaagcccggctgggccgcggcgagcgggcactgatcctgctg
gacaacgacgaatactacgccatcagcatgtttgcctgcttctatgcgggtgtcatcgcg
gtaccggtgttcccgccggagtcggccagtgccgcgcacaccgggcggctggcggggatc
gctgccgatgccggcgcgcgcgggctgctcatccttgacgccaaccgggcgctggtcgcc
gcctgcgaggggctgcagcaggccgagatgatcgctgtcgaccagatcggcgcaggcgat
cggggcccgtggcaggcagccgccccggatccgcaggagatcgccttcctgcaatacacc
tccggctctacctcggcacccaagggggtgatggtcacgcacgccgccttgatggctaac
gaagccgccattcgtgagggcttgtccatcggcgagggcgacagcttctgcgtctggtcg
ccgttgttccatgacatgggacttatcggtggtctgttgcagcctttttacagcgggatt
gtctgcgtgctgtgctcgccccgctatttcctggagcgcccggtgcgctggttgcagatg
attgcgcgtcatcgcgtgagcatcagcggcgggccggattttgcttatcggctctgtctg
gaccgtatcaaggatcgtcaactcgagggtctggacctgtcctgctggcgtgtcgcctat
accggtgcggagccggtgcgccaccagaccatggaggcgttcgtgcagcgcttcgccagc
gtcggtctcgaccctgcggcggtgtacccctgctacggtctggctgaggcaaccctgttt
gttaccggcgggcggcgcggtgcgggactgcgcgtacagcgctatctgccacacgcactg
aggtctcgcctggccttgcccgccgacgcagaggaaccagcggtggcgctggtggcctgc
ggccgcgcgccaagccagcatcaggtgcgcatcgctgccgatgcctcgggcgcgccggcg
gcgccggggggcatcggcgaaatctgggtgactggtccgagcatcgcgcgcggttactgg
aagcaagcgctgcagagtgcccagaccttcgttgagctggagaaccagacctggctgagg
accggggatctgggcttctgggctgacggcgaacttttcgtggccggacgcctgaaagac
atgatcatcgtgcgcggccacaacatctatccgcaggatctcgaacaagccctggaagcc
gaggtggaagccttgcgcaaaggccgcatcgccgtgttcgccgtcagcctggatacggag
gagggcgtcggcgttgccgtcgaggtgtcgcggggtatgcaaaagctggtggccccgcaa
gccttgtgcgaggcggttgccacggtggtgcaaaggcagtgtggagaagcgccgcaagtg
cttgtgctgctcaatccaggaggcttgcccaagacctccagcggcaagctgcaacgcggc
gcatgtcgcaccggctggcatcagggaagtctggacgcctacgccgttttcgagcaggga
cgcatggtgcagggcagccagtcgacgacgatggcaacagtaccgcccgtcgctgcgcag
cgcgctggtgagccggaagtgcgggccgctctggcgctgctgtggcaagaggtattgatg
ccgggcgtggccggagagccatctgccgacgcccactttctggcctgcggcggcaattcg
ctggcggcggtgcaactggccgcgcggatttcccagcattggcagattgcattcgctgcg
tctcaggtatttgaatacccacggctgcagcagcaggcggcactgatcctggatgcgctg
gaagatggcaagggtggcactgccaccggcatcgcgcgcctgtccgaggcacagcgacgc
acaccgcagcccctgtcgtcagcacagcagcgccaatggtttctctggcaactggcaccg
caaagtacggcctatcacgtgcaaggtgcgctgcgcctgggaggcccactcgatgtgttc
gccctgcaacgtgccttcaatgcactgatgcggcgccatgaggtcttgcagaccgtgttc
cgcagcactgatcagggccagctcgagcaggtcgtcgggacgcagccggtagccgagctg
gagctggtcgaagccgataccgggcccaacggcgcgctgtcgctgccagccgcgctggat
ctgctgcaacaacgccacggacagcccttcgatctcacgcacgggccgctggtgcgtgcc
tgtctgctggctctggacgatggcagccatgtgctgggcatggtcatgcaccatatcatt
tcggatggcgcatccatgcatctgctcatcgaggaactggcgcagctctacgcggaactg
cacgctggcaggcagagcgccctggcaccggccatcttgcactatgtcgactacatcgcc
tggcaacaggcccgtgcggatgacccggaacatcgtgtcgcgctggattactggacccgg
gagctggcggttcctgccggccaggcccagccggtactggcgctgccggtcgacagagcg
cgtccggtgctcgcgcgctatcacgccagccatcatcatttcgccctgccggatgatctg
ttggcgggattgcgcgggcaggcaaggcaagcaggcatgacccttttcgcgctactgctg
agcgggctgcaagccttgctgcatcgctacaccgggcagcaagacatccgggtcggcgtg
ccggtggcaaaccgcagccatcctgatctgctgggtgtggttggcttcttcgtcaatacc
ctggtgctgcgcgccccgttcgacgaggacatcacgctggcccaactgctggcgcagacc
gctcaacgcacgctactggcccagcggcatcaagggctgccgttcgaacaattggtggag
gtactgcaacccgaacgcagcctgacccacagtgcactgttccaagtcatgttcaaccac
ctgccacagcactatgcggcaagtgcacagggcctgggcgacgtggtcgaggagctgttc
cttcccgaccgcgaggcccagttcgagttgacgctggatacccgcgaacatccagatggc
cgcgtcagcgccgtgctgacctatgccaaggaattgtttgatccgcagcgcattgcgcaa
ctggcgcagagctatctggcgatcctgcgcgccctggtggacgagccgcaacagctggtc
gccgaagttgccctgctatctccagcgcagcaggcgcagttgcagcagtggggctgcaat
ccgcagcgctatccgctcgatccgccgatacatgttcgcattgcgcagcaggcccggcgc
acgccagaggccatcgcgctggtgctggaccggcagcagttgagctatgcgcagctggag
gcacgcgccaaccagatggcacgacagctactggcaatgggtgtgcagcctgagcagcgc
atcggactggcgctggagcgctcgctggacatggtgccggccttgctggccatcctcaag
gcaggcgcttgcttcgtgccgctcgatccgcaatacccgcgagcgcgcctgacggccatg
atcgaggacagtcgcatccgtctggcgctcacgcaaagccatatgcgcgagcatttgccc
gggcaggccggtgtgcgctggctggaactggaccgcttgccagcacctgcggccacgtcc
gattttatggaagcgccggacgtcatcacccatccggctcagttggcctacgtcatctac
acctcgggctcgaccgggcgacccaagggggtcgcggtatcacatggggccttggtcgag
catacgcaattgtcggcggagttctcgcgcctgcgcaacgatgaccgcatgttgcaattt
gccacactcaatttcgacggtttcatcgaacagctgtttccgccgctgctggtgggtgcg
tcggtggtcctgcgcgggccacagttatggagtcccgaggaatttcagcaacggctgcgt
gagcatgacatcagcatcgccgatctgcccacggcctactggcacgccctgatccaatcg
ttcgcccgccaggggcagagtgattacggccgcttacgcgagatccacattggtggcgaa
gccatgccggccgagtcgattgcgacctggcgccaggccggcctgagtgcggtgcgcctg
ctcaatacctacggccctacagaggcggtggtagtggcctcactgctcgattgcgatcct
ttcgtccagggccagcgcgaggtgccgacccagatgccgatcggacagcccctggccggg
cgcagtctgcatgtgctcgacgagcgtctacaagcgctgccagcgggggtgcccggcgaa
ctctacatcggcggcgacctgctggcacggggctatctggagcgaccgggcctgacggcc
gagcgtttcgtcgccgatcccggcagtgaggccggtggccggctgtatcgcaccggcgat
ctggtgtgctggaacgcccagagcgaactgcactatctgggacgcagcgaccttcaggtc
aaactccggggattccgcgtcgagcttggcgagatcgaagcgcaattgctggcgcaaccg
gaggtgcgccaggccatcgtcgtggcgcaccaggcgcggctggtgggctacgccagcctg
tatccgggccaggagctgagtacggcgcaattgcgggaacgcttgcgcgccagcctgccc
gactacatggtgccggccacggtgatcgtgctggaacagttgccgaccaatccaaacggc
aagatcgaccgccatgccttgcccgcacccgccgacgtcattgccgtgggcggactagcc
ccggtgggccaactggaggagcaactgggggggatctggcgcgaactgctgcggctcgaa
caggtgggccgcgacgacaatttctttgaactgggcggtcattccttattgctgctggtg
gcgcatgagcgcatcaaggcactgtcgcttgcctgcgtgcctagcgtggtggatctgttc
cgatatccgaccatcgccacgctggcggcgttcctcgacggcgccgccccgacccgcaac
gatgccggcccggcccttgaagaacgcgccgcacgccagcgcggaggcttcctgtcacgc
cgcagacagccctcaggagcagagcaatga

DBGET integrated database retrieval system