KEGG   Herbaspirillum rubrisubalbicans: Hrubri_2562Help
Entry
Hrubri_2562       CDS       T04238                                 

Definition
(GenBank) ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Hrubri_2562
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hrb03400]
    Hrubri_2562
Enzymes [BR:hrb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Hrubri_2562
DNA repair and recombination proteins [BR:hrb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Hrubri_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ALU89743
UniProt: A0A0U3LYM1
LinkDB All DBs
Position
complement(2975521..2978106)
Genome map
AA seq 861 aa AA seqDB search
MSASSLDRYHARRDFSITPEPSGHGRQTARSAQGPLQFFIQRHHARRLHYDFRLELDGVL
KSWAVPKGPSLDPHDKRLAVRVEDHPLDYGSFEGDIPAQQYGAGHVVLWDRGQWLPHGDP
QAGLKQGHLGFTLQGDKLQGRWALVRMGKPERDGKENWLLIKEDDAAAQTGEAAAITELR
PESVKDRGDLPSAASELAHGVSQADAIEPHPARIPDVMPAQLATLVDQAPQGEDWLCELK
FDGYRGLCRIEGGQAAIYTREGLDWSHRWPVLVQALARLPVDQAWIDGEVVALDAAGHIS
FEALQNLVRGDRQQADGIRLALYVFDLPYLNGYDLRAVPLTQRKALLRELVPGSDEEGLL
LYSEHLLGHADEVLRHACQHGMEGIVVKRADAPYSGRRDRNWLKLKCEQRQEFVIAGYTD
PAGQRSGFGAILVGVYDDQGQLHYAGRVGTGFDERLLGRMLKLFQRLEQDRPAFVDPPTG
QQRRGVHWLKPELVAEVKFAQWTKSGILRHGSFVALREDKPPTSIVRETQQPVAADAPAA
EEGTAPSPPSPPSRRPSPADLSQPVMVAGVKLTHPGKILFPATGLTKLELARYYQSVAPW
ILPELKQRPLSLVRCPDGQAGKCFFQKHSGQGMPEAIDTIQVPEGEGTAQYMMVNDVAGL
VATVQMGVLELHAWGATGRALDQPDRVVFDLDPAPDVPWASVVEGAQLVRALLQEIGLES
YLKTSGGKGLHVMVPMRPEHDWDVVKDWAHRLAAHLARLLPERFIARMSKAARAGKIFID
YLRNAPGATTVVAYSVRARDGAPVSVPITWEELEQGVRADHFKVATMPQRLQSLAHSDPW
AGFGQPRQRLTKAMLAAFDPV
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttcttccctggatcgctaccacgccaggcgcgacttcagtattacgccagaa
ccttcaggtcatggtcgccaaacggcccgctcagcccaggggccgctgcaattcttcata
cagcgccaccatgcgcggcgcctgcactacgacttccggctggagcttgatggcgtgctc
aagagctgggcggttccgaaagggccgagcctggatccgcatgacaagcgcctggcggta
cgggtcgaggatcatccgctggattacggcagtttcgagggcgatattccggcgcagcag
tatggcgccggccacgtggtgctgtgggatcgcgggcaatggctgccgcatggcgaccca
caggccggtttgaagcaaggtcatctcggtttcaccctgcagggcgacaagctgcagggc
cgctgggcgctggtgcgcatgggcaagccggagcgcgatggcaaggagaattggctattg
atcaaggaggatgacgctgccgcccagaccggcgaggccgcggccattaccgaattgcgc
ccggaaagcgtgaaagatcgcggtgaccttccgtctgcggccagcgagcttgcccatgga
gtcagccaggctgatgctatagagccgcatcccgccaggataccggatgtgatgccggcg
caactggcgaccctggtcgaccaggcgccccagggtgaagactggctctgcgaactgaaa
ttcgacggttatcgcggcctgtgtcgcattgagggcggccaggctgccatctacacccgc
gaaggcctggactggagccatcgctggccggtgctggtgcaggcgctggcgcggctgccg
gtggaccaggcctggatcgatggcgaagtggtggcgctggacgccgcggggcacatcagc
tttgaagccctgcagaacctggtgcgcggcgaccgtcagcaggccgacggcatccggctg
gcgctgtatgtattcgatctgccttacctgaatggctacgacttgcgcgccgtcccgctg
acgcagcgcaaggcgctgctgcgcgagctggtccccggcagtgatgaagagggattgctg
ctctatagcgagcatctcctcggtcatgccgatgaagtattgcgccatgcttgccagcac
ggcatggagggcatcgtggtcaagcgcgccgatgcgccctatagcggccgacgcgaccgc
aactggctcaagctcaagtgcgagcagcgacaggaattcgtgatcgccggctataccgat
ccggccggccagcgcagcggtttcggcgccatcctggtgggggtctatgacgatcagggg
caattgcactacgccggccgcgtcggcaccggttttgatgagcgcctgctgggccgtatg
ctcaagctgttccagcggctggagcaggatcgtccggctttcgtcgatccccctaccggc
cagcagcggcgtggcgtgcactggctcaagccggaactggtggccgaagtgaagtttgcg
caatggaccaaaagcggtatcctgcgccacggcagcttcgtggccctgcgcgaagacaag
ccgcctaccagtatcgtgcgcgagacacagcagccggtagcagccgatgcgcctgccgca
gaggagggtacagcgccttcacccccgtcacccccgtcgcgcagacctagccccgccgat
ctctcccaaccggtcatggtggctggggtcaagctcacgcatcccggcaagatcctcttt
cccgccactgggctgaccaagctggaactggcccgttactaccagagcgtggcgccctgg
atcctgcccgaactgaagcagcgcccgttgtcgctggtgcgctgcccggacggtcaggcc
ggcaagtgcttcttccagaagcacagcggccagggaatgcctgaagccatcgataccatc
caggtgccggaaggcgaggggacggcgcagtacatgatggtcaatgacgtggccgggctg
gtggcgaccgtccagatgggcgtactggaattgcacgcctggggcgccaccggccgtgcg
ctggatcagcctgaccgcgtagtgttcgacctggacccggccccggacgtgccttgggcc
agcgtagtggagggcgcccaactggtgcgcgccctgttgcaggaaatcggcctggagagc
tatctgaagacttcgggcggcaagggcttgcacgtcatggtgccgatgcgccccgagcat
gactgggacgtggtcaaggattgggcgcaccggttggcggcccacctggcgcggctgctg
ccggagcgattcatcgcccgcatgagcaaggcggcgcgcgccggcaagatattcatcgac
tacctgcgcaatgccccgggggccaccacggtggtggcctattcggtgcgggcccgcgat
ggtgcgccggtgtcggtaccgatcacctgggaagagctggagcagggcgtgcgggccgat
catttcaaggtggccaccatgccccagcggctgcaaagcctggcccacagcgacccttgg
gccggtttcggccagccccggcagcgcctgaccaaggccatgctggcggccttcgatcca
gtctga

DBGET integrated database retrieval system