KEGG   Herbaspirillum rubrisubalbicans: Hrubri_2997Help
Entry
Hrubri_2997       CDS       T04238                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00020  Citrate cycle (TCA cycle)
hrb00190  Oxidative phosphorylation
hrb00650  Butanoate metabolism
hrb01100  Metabolic pathways
hrb01110  Biosynthesis of secondary metabolites
hrb01120  Microbial metabolism in diverse environments
hrb01130  Biosynthesis of antibiotics
hrb01200  Carbon metabolism
Module
hrb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hrb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hrb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hrubri_2997 (sdhA)
   00650 Butanoate metabolism
    Hrubri_2997 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Hrubri_2997 (sdhA)
Enzymes [BR:hrb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Hrubri_2997 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Hrubri_2997 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALU90166
UniProt: A0A0U3KBJ8
LinkDB All DBs
Position
complement(3488204..3489982)
Genome map
AA seq 592 aa AA seqDB search
MAAIKSAITTRRFDAVIVGAGGSGMRASLQLAEAGLNVAVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWYWHMFDTVKGSDYLGDQDAIEFMCREAPKAVYELEHFGMPFDRNPDGTIY
QRPFGGHTANLGEKPVQRACAAADRTGHALLHTLYQRNVRAKTHFFVEWMALDLIRNEEG
DVLGVVALEMETGEIMMLHAKTTLFATGGAGRIWAASTNAFINTGDGMGMAARAGLPLQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPHKDHVLLDLRHIGADTIKKRLPSILEIAHKFANVDATKEPIPVVPTIHYQ
MGGIPTNVHGQVVAPKGGSMKEVVQGMYAIGECACVSVHGANRLGTNSLLDLVVFGRAAG
NHIVGTRLQDQSHKPIPAGALDRSLERIAHLESSTGSERVQDVANDIRATMQKYCGVFRT
DALLQEGYKKIMELDERRKHVSFKDKSKVFNTARVEALELDNLIETAKATITSAAARKES
RGAHAHSDYEQRDDVNWLKHTLWFSEGNRLDYKPVNMQPLTVETFKPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcaatcaaatccgccatcactacccgccgctttgacgcggtcatcgtcggcgcc
ggtggctccggtatgcgcgcctcgctgcaactggccgaagccggcctgaacgtcgctgtc
ctgtccaaggtcttcccgacccgctcgcacaccgtggctgcccaaggcggcatcggcgct
tcgctgggcaatatgtccgaagacaactggtactggcacatgttcgataccgtcaagggt
tcggactacctgggcgaccaggacgccatcgaattcatgtgccgcgaagcaccgaaggcc
gtctacgagctggaacacttcggtatgcccttcgaccgcaacccggatggcaccatctac
cagcgtccgttcggtggtcacaccgccaacctgggcgaaaagccggtgcagcgtgcctgt
gccgccgctgaccgtaccggtcacgcgctgctgcacaccctgtaccagcgtaacgtgcgc
gccaagacccacttcttcgtcgaatggatggcgctggacctgatccgcaacgaagagggc
gatgtcctcggcgtggtcgcgctggaaatggaaaccggcgaaatcatgatgctgcacgcc
aagaccaccctgttcgccaccggcggtgcaggtcgtatctgggccgcctcgaccaatgcc
ttcatcaataccggcgacggtatgggcatggccgcgcgtgccggcctgccgctgcaggac
atggaattctggcagttccaccccaccggcgtggccggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcatcctgatcaacagcaacggcgaacgcttcatggagcgc
tacgcgccgaccctgaaggatctggccccgcgtgacttcgtttcgcgttcgatggaccag
gaaatcaaggaaggccgtggcgtcggtccccacaaggatcacgtgctgctggatctgcgc
cacatcggtgccgataccatcaagaagcgcctgccctcgatcctggaaatcgcccacaag
ttcgccaacgtcgatgcgaccaaggaaccgatcccggtcgtgccgaccatccactaccag
atgggtggcatccccaccaacgtccatggtcaggtggtcgcacccaagggtggttcgatg
aaggaagtggtgcagggcatgtacgccatcggcgaatgcgcctgcgtgtcggtgcacggc
gccaaccgcctgggcaccaactcgctgctggacctggtggtgttcggtcgcgccgccggc
aaccacatcgtcggcacccgtctgcaggaccagagccacaagccgatcccggctggcgcc
ctggaccgttcgctggagcgcattgcgcacctggaaagcagcaccggttccgagcgcgtg
caagacgtggccaacgacatccgtgccaccatgcagaagtactgcggcgtgttccgtacc
gacgccctgctgcaggaaggctacaagaagatcatggagctggacgagcgccgcaagcac
gtctcgttcaaggacaagtccaaggtgttcaacactgcccgcgtggaagcgctggaactg
gacaatctgatcgaaaccgccaaggccaccatcacctcggccgcagctcgcaaggaatcg
cgtggcgcccacgcccacagcgactacgagcaacgcgacgacgtgaactggctcaagcac
acgctgtggttctccgaggggaatcgtctcgactacaagccggtcaacatgcagccgctg
accgtcgagaccttcaaacctaaagcacgtactttctaa

DBGET integrated database retrieval system