KEGG   Herbaspirillum rubrisubalbicans: Hrubri_3413Help
Entry
Hrubri_3413       CDS       T04238                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00040  Pentose and glucuronate interconversions
hrb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hrubri_3413
Enzymes [BR:hrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Hrubri_3413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DAO
Motif
Other DBs
NCBI-ProteinID: ALU90573
UniProt: A0A0U3JV25
LinkDB All DBs
Position
3991003..3992040
Genome map
AA seq 345 aa AA seqDB search
MQALVLEATRQLSLREIDLPQQVGPQDVRIRIHTVGICGSDLHYYTHGSIGPFKVEAPMV
LGHEASGTVIEVGSAVRHLKVGDRVCMEPGIPRLDSPATLRGMYNLDPSVRFWATPPIHG
CLTDSVVHPAAFTYRLPDNVSFAEGAIVEPLSIGLQAATKARMKPGDTAVVIGAGTIGAM
TALAALAGGAARVILADVVAQKLAHFAGNPAVTTVDVSQQSLVEVVQQRTEGWGADVVFE
ASGHAGVYHHLLEMICPGGCAVLVGMPAAPVALDVVAMQTREVRLESVFRYANIFPRALA
LISSGMIDVKPFISRSFPFSQSIRAFEEAASGQPQDVKIQIEMAG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccctcgtactggaagccacgcgccaactatcgctgcgcgagatcgacctgccg
caacaagtggggccacaggatgtgcgcatccgcatccacacggtgggcatctgcggcagc
gacctgcactattacacccacggcagcattggccccttcaaggtggaagcgcccatggtg
ctgggccacgaagcctcgggcacggtcatcgaggtcgggagtgccgtgcgccatctcaag
gtcggcgaccgcgtctgcatggaacccggcatcccacgcctggattcaccggccacgctg
cgcggcatgtacaacctcgacccttccgtgcgcttctgggccacgccaccgatccacggt
tgcctcaccgacagcgtggtgcatccggccgccttcacctatcgcctgccagacaatgtc
agctttgccgaaggcgccatcgtcgaaccgctgtccatcggcctgcaagccgccaccaag
gcgcgcatgaagccgggcgacacggccgtggtgatcggtgccggcaccatcggcgccatg
accgcactggcggcgctggccgggggcgcggcgcgggtgatcctggccgatgtggtggcg
caaaagctggcgcactttgccggcaatccggcggtgaccaccgtcgatgtcagccagcag
tcgctggtggaggtggtgcagcagcgtaccgaaggctggggcgccgatgtggtgttcgag
gcctccggtcatgccggcgtctaccaccacctgctggagatgatctgccctggcggctgc
gcggtgctggtcgggatgccggccgcaccggtggccctggacgtggtggccatgcagacc
cgtgaagtgcgactggaatcggtgtttcgctacgccaacatcttcccgcgagcactcgcc
ctgatcagctcgggcatgatcgatgtgaagcccttcatctcgcgcagcttccccttctcg
caaagcatccgcgccttcgaagaagccgccagcggccagccgcaggatgtgaagatccag
atcgaaatggcaggctga

DBGET integrated database retrieval system