KEGG   Herbaspirillum rubrisubalbicans: Hrubri_3482Help
Entry
Hrubri_3482       CDS       T04238                                 

Gene name
rpiA
Definition
(GenBank) Ribose 5-phosphate isomerase protein
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
hrb  Herbaspirillum rubrisubalbicans
Pathway
hrb00030  Pentose phosphate pathway
hrb01100  Metabolic pathways
hrb01110  Biosynthesis of secondary metabolites
hrb01120  Microbial metabolism in diverse environments
hrb01130  Biosynthesis of antibiotics
hrb01200  Carbon metabolism
hrb01230  Biosynthesis of amino acids
Module
hrb_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hrubri_3482 (rpiA)
Enzymes [BR:hrb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Hrubri_3482 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: ALU90641
UniProt: A0A0U3K7M8
LinkDB All DBs
Position
complement(4082981..4083652)
Genome map
AA seq 223 aa AA seqDB search
MTQDELKQAVAKAAIDYVVDGEIIGVGTGSTANFFIDELGKIKHRIKGAVASSEATAERL
RSHGITVFDLNEVETMPVYIDGADEINGAGAMIKGGGAALTREKIVASVAQKFVCIADGS
KLVEVLGKFPLPVEVIPMSHAVVARKLAALGGQPRLRLKDGQPLVTDNGCYIIDLLGLSI
TDPADIEDKINNIVGVVTNGLFARQGANVCLLGTAEGVKKLEF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagacgaactcaagcaggcagtcgccaaggctgccatcgactacgtggtcgat
ggcgaaatcatcggtgtgggcaccggctccacggccaatttcttcatcgatgagctgggc
aagatcaagcaccgcatcaagggcgcggtggcctcctccgaagccactgccgaacgcctg
cgttcgcacggcatcaccgtgttcgatctcaacgaggtcgagaccatgccggtgtatatc
gatggcgccgacgaaatcaatggtgccggcgccatgatcaagggcggtggtgctgcgctc
acgcgcgagaagatcgtggcgtcggtggcgcagaagttcgtctgtatcgccgatggctcc
aagctggtcgaggtgctgggcaagttcccgctgccggtagaagtgatcccgatgtcgcac
gccgtggtggcccgcaagctggccgcactgggtggccagccgcgcctgcgtctgaaggat
ggccagccgctggtgaccgacaacggttgctacatcatcgacctgctgggcctgtccatc
accgatccggccgacatcgaagacaagatcaacaacatcgtcggcgtggtcaccaatggc
ctgtttgcgcgccagggggccaatgtctgcctgttgggcactgccgagggtgtcaagaag
ctggagttctga

DBGET integrated database retrieval system