KEGG   Herbaspirillum rubrisubalbicans: Hrubri_4232Help
Entry
Hrubri_4232       CDS       T04238                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, subunit F, protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hrb  Herbaspirillum rubrisubalbicans
Brite
KEGG Orthology (KO) [BR:hrb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hrubri_4232 (ahpF)
Enzymes [BR:hrb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Hrubri_4232 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 FAD_binding_3 Glutaredoxin NAD_binding_7 HI0933_like Thi4 NAD_binding_8 FMO-like DAO AlaDh_PNT_C K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALU91379
UniProt: A0A0U3LP05
LinkDB All DBs
Position
complement(4959229..4960830)
Genome map
AA seq 533 aa AA seqDB search
MLDANLKTQLKAYLEKVSHPIEIVASLDDGAKSREMQELLQEIVLLSDRISLVEHRGTSK
DARTPSFKLHRPGTNISVEFAAIPMGHEFTSLVLALLQVGGHPIKLDDKVIEQIRNLDGD
YRFETYVSLTCQNCPEVVQALNVMSIINPRIQSVTIDGALFQGEVEQRQIMAVPTVYMNG
EVFGQGRTGVEEILAKLDTGAAARKGEELSAQAPYDVLIVGGGPAGAAAAIYAARKGIRT
GVVAERFGGQVLDTLAIENFVSVQETEGPQFATALEQHVRAYDVDIMNVQRAEALVPGDK
LIEVKLANGGVLKGKTVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVSVI
GGGNSGVEAAIDLAGIVAHVTLIEFAAELKADAVLVRKLKSLPNVTIVTSAQTTEITGDG
QRVNGISYKERDTGEIKHVALEGVFVQIGLVPNTEWLKGTLALSKHGEIEIDAKGQTSIP
GVFAAGDVTTVPYKQIVIAVGAGATAALSAFDHLIRSSADDVAPAATKEAVAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagacccaattgaaggcctatctggaaaaggtcagccacccg
atcgagatcgtcgcgtcgctcgatgatggcgccaaatcccgtgagatgcaggaactcctg
caagaaatcgtgctgctgtccgaccgtatcagcctggtcgaacatcgcggtaccagcaag
gacgcgcgtactccgtccttcaagttgcatcgccccgggaccaacatcagcgtcgaattc
gccgcgatcccgatgggccacgaatttacctctctggtgctggccctgttgcaagtgggc
ggccacccgatcaagctcgacgacaaggtcatcgagcagatccgtaacctggacggcgac
taccgcttcgagacctatgtctcgctgacctgccagaactgcccggaagtggtgcaggcc
ttgaacgtgatgtccatcatcaacccgcgcatccagtcggtgaccatcgatggcgcgctg
ttccagggtgaagtcgagcagcgccagatcatggccgtgccgaccgtctatatgaacggc
gaagtcttcggccagggccgtaccggcgtcgaagagatcctcgccaagctcgacactggc
gctgccgcccgcaagggtgaagaattgagcgcacaggcgccgtatgacgtgttgatcgtc
ggcggtggcccggccggtgccgccgctgccatctatgcagcgcgcaagggtatccgtacc
ggtgtggtggccgagcgtttcggcggccaggtgctcgataccctggccatcgagaacttc
gtctcggtgcaggaaaccgaaggtccgcaattcgccaccgccctggaacagcacgtcagg
gcctatgacgtcgacatcatgaacgtgcagcgcgccgaggcgctggtgccgggcgacaag
ttgatcgaagtgaagctggccaatggcggcgtgttgaagggcaagaccgtgatcctgtcc
accggtgcacgctggcgcaacgtcaacgtgccgggcgagcaggaatacaagaacaagggc
gtggcctattgcccgcactgcgatggtccgctgttcaagggcaagcgcgtgtcggtgatc
ggtggcggcaactcgggcgtggaggcggccatcgacctggccggcatcgtcgcccatgtg
accttgatcgaattcgctgccgaactgaaggccgatgcggtgctggtgcgcaagttgaag
agcctgcccaacgtcaccatcgtgacctcggcgcagaccaccgagatcaccggcgacggt
cagcgcgtcaatggcatcagctacaaggaacgggataccggcgagatcaagcacgtggcg
ctggaaggcgtgttcgtccagatcggcctggtgcccaacaccgaatggctgaaggggacc
ctggccttgtccaagcacggcgagatcgagatcgatgccaagggccagacctcgattccg
ggtgtcttcgccgctggcgacgtgaccaccgtgccgtacaagcagatcgtcatcgccgtg
ggtgctggtgcgacggcggccctgtcggccttcgatcacctgatccgctcctcggccgat
gacgtggccccggcggcgaccaaggaagccgtggctgcctga

DBGET integrated database retrieval system